PDB entry 3iba

View 3iba on RCSB PDB site
Description: Crystal structure of the complex of Trypanosoma cruzi farnesyl diphosphate synthase with zoledronate, IPP and Mg2+
Class: transferase
Keywords: FPPS, Trypanosoma cruzi, bisphosphonate, isopentenyl pyrophosphate, Chagas disease, Isoprene biosynthesis, Transferase
Deposited on 2009-07-15, released 2010-02-09
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-04-17, with a file datestamp of 2013-04-12.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.229
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: farnesyl pyrophosphate synthase
    Species: Trypanosoma cruzi [TaxId:5693]
    Gene: FPPS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3ibaa_
  • Heterogens: MG, ZOL, SO4, IPE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ibaA (A:)
    masmerflsvydevqaflldqlqskyeidpnrarylrimmdttclggkyfrgmtvvnvae
    gflavtqhdeatkerilhdacvggwmieflqahylveddimdgsvmrrgkpcwyrfpgvt
    tqcaindgiilkswtqimawhyfadrpflkdllclfqkvdyatavgqmydvtsmcdsnkl
    dpevaqpmttdfaeftpaiykrivkykttfytyllplvmglfvseaaasvemnlvervah
    ligeyfqvqddvmdcftppeqlgkvgtdiedakcswlavtflgkanaaqvaefkanygdk
    dpakvavvkrlyseanlqadfaayeaevvreveslieqlkvksptfaesvavvwekthkr
    kk