PDB entry 3iar

View 3iar on RCSB PDB site
Description: The crystal structure of human adenosine deaminase
Class: Hydrolase
Keywords: deaminase, adenosine deaminase, adenosine, purine metabolism, Structural Genomics, Structural Genomics Consortium, SGC, Disease mutation, Hereditary hemolytic anemia, Hydrolase, Nucleotide metabolism, SCID
Deposited on 2009-07-14, released 2009-08-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.52 Å
R-factor: 0.154
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: adenosine deaminase
    Species: Homo sapiens [TaxId:9606]
    Gene: ADA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00813 (1-359)
      • expression tag (360)
    Domains in SCOPe 2.07: d3iara1, d3iara2
  • Heterogens: 3D1, NI, NO3, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3iarA (A:)
    mpafdkpkvelhvhldgsikpetilyygrrrgialpantaegllnvigmdkpltlpdfla
    kfdyympaiagcreaikriayefvemkakegvvyvevrysphllanskvepipwnqaegd
    ltpdevvalvgqglqegerdfgvkarsilccmrhqpnwspkvvelckkyqqqtvvaidla
    gdetipgssllpghvqayqeavksgihrtvhagevgsaevvkeavdilkterlghgyhtl
    edqalynrlrqenmhfeicpwssyltgawkpdtehavirlkndqanyslntddplifkst
    ldtdyqmtkrdmgfteeefkrlninaakssflpedekrelldllykaygmppsasagqnl
    aenlyfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3iarA (A:)
    pafdkpkvelhvhldgsikpetilyygrrrgialpantaegllnvigmdkpltlpdflak
    fdyympaiagcreaikriayefvemkakegvvyvevrysphllanskvepipwnqaegdl
    tpdevvalvgqglqegerdfgvkarsilccmrhqpnwspkvvelckkyqqqtvvaidlag
    detipgssllpghvqayqeavksgihrtvhagevgsaevvkeavdilkterlghgyhtle
    dqalynrlrqenmhfeicpwssyltgawkpdtehavirlkndqanyslntddplifkstl
    dtdyqmtkrdmgfteeefkrlninaakssflpedekrelldllykaygmppsasagqnla