PDB entry 3iam

View 3iam on RCSB PDB site
Description: Crystal structure of the hydrophilic domain of respiratory complex I from Thermus thermophilus, reduced, 2 mol/ASU, with bound NADH
Class: oxidoreductase
Keywords: oxidoreductase, electron transport, respiratory chain
Deposited on 2009-07-14, released 2009-09-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.232
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '1':
    Compound: NADH-quinone oxidoreductase subunit 1
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3iam11, d3iam12, d3iam13
  • Chain '2':
    Compound: NADH-quinone oxidoreductase subunit 2
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3iam2_
  • Chain '3':
    Compound: NADH-quinone oxidoreductase subunit 3
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3iam31, d3iam32, d3iam33, d3iam34
  • Chain '4':
    Compound: NADH-quinone oxidoreductase subunit 4
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3iam4_
  • Chain '5':
    Compound: NADH-quinone oxidoreductase subunit 5
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3iam5_
  • Chain '6':
    Compound: NADH-quinone oxidoreductase subunit 6
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3iam6_
  • Chain '7':
    Compound: NADH-quinone oxidoreductase subunit 15
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3iam7_
  • Chain '9':
    Compound: NADH-quinone oxidoreductase subunit 9
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3iam9_
  • Chain 'A':
    Compound: NADH-quinone oxidoreductase subunit 1
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3iama1, d3iama2, d3iama3
  • Chain 'B':
    Compound: NADH-quinone oxidoreductase subunit 2
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3iamb_
  • Chain 'C':
    Compound: NADH-quinone oxidoreductase subunit 3
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3iamc1, d3iamc2, d3iamc3, d3iamc4
  • Chain 'D':
    Compound: NADH-quinone oxidoreductase subunit 4
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3iamd_
  • Chain 'E':
    Compound: NADH-quinone oxidoreductase subunit 5
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3iame_
  • Chain 'F':
    Compound: NADH-quinone oxidoreductase subunit 6
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3iamf_
  • Chain 'G':
    Compound: NADH-quinone oxidoreductase subunit 9
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3iamg_
  • Chain 'H':
    Compound: NADH-quinone oxidoreductase subunit 15
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3iamh_
  • Heterogens: SF4, FES, FMN, NAI, MG, CA

PDB Chain Sequences:

  • Chain '1':
    Sequence, based on SEQRES records: (download)
    >3iam1 (1:)
    mtgpilsgldprfertlyahvgkegswtldyylrhggyetakrvlkektpdevieevkrs
    glrgrggagfptglkwsfmpkddgkqhylicnadesepgsfkdryiledvphlliegmil
    agyairatvgyiyvrgeyrraadrleqaikearargylgknlfgtdfsfdlhvhrgagay
    icgeetalmnsleglranprlkppfpaqsglwgkpttinnvetlasvvpimergadwfaq
    mgteqskgmklyqisgpvkrpgvyelpmgttfreliyewaggplepiqaiipggsstppl
    pfteevldtpmsyehlqakgsmlgtggvilipervsmvdamwnltrfyahescgkctpcr
    egvagfmvnlfakigtgqgeekdvenleallpliegrsfcpladaavwpvkgslrhfkdq
    ylalarekrpvprpslwr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3iam1 (1:)
    tgpilsgldprfertlyahvgkegswtldyylrhggyetakrvlkektpdevieevkrsg
    lrgrggagfptglkwsfmpkddgkqhylicnadesepgsfkdryiledvphlliegmila
    gyairatvgyiyvrgeyrraadrleqaikearargylgknlfgtdfsfdlhvhrgagayi
    cgeetalmnsleglranprlkppfpaqsglwgkpttinnvetlasvvpimergadwfaqm
    gteqskgmklyqisgpvkrpgvyelpmgttfreliyewaggplepiqaiipggsstpplp
    fteevldtpmsyehlqakgsmlgtggvilipervsmvdamwnltrfyahescgkctpcre
    gvagfmvnlfakigtgqgeekdvenleallpliegrsfcpladaavwpvkgslrhfkdqy
    lalarekrpvprpslwr
    

  • Chain '2':
    Sequence, based on SEQRES records: (download)
    >3iam2 (2:)
    mgffddkqdfleetfakyppegrraaimpllrrvqqeegwirperieeiarlvgttptev
    mgvasfysyyqfvptgkyhlqvcatlscklagaeelwdyltetlgigpgevtpdglfsvq
    kveclgschtapviqvndepyvecvtrarleallaglragkrleeielpgkcghhvheve
    v
    

    Sequence, based on observed residues (ATOM records): (download)
    >3iam2 (2:)
    gffddkqdfleetfakyppegrraaimpllrrvqqeegwirperieeiarlvgttptevm
    gvasfysyyqfvptgkyhlqvcatlscklagaeelwdyltetlgigpgevtpdglfsvqk
    veclgschtapviqvndepyvecvtrarleallaglragkrleeielpgkcghhvheve
    

  • Chain '3':
    Sequence, based on SEQRES records: (download)
    >3iam3 (3:)
    mvrvkvndrivevppgtsvmdavfhagydvplfcsekhlspigacrmclvriglpkkgpd
    gkpllnekgepeiqwqpklaascvtavadgmvvdtlsdvvreaqagmveftllnhpldcp
    tcdkggacelqdrtveyglyekyyqkgplelpvytrfeftrrhvdkhhplspfvildrer
    cihckrcvryfeevpgdevldfiergvhtfigtmdfglpsgfsgnitdicpvgalldlta
    rfrarnwemeetpttcalcpvgcgitadtrsgellrirarevpevneiwicdagrfghew
    adqnrlktplvrkegrlveatweeaflalkeglkeargeevglylahdatleegllasel
    akalktphldfqgrtaapaslfppasledllqadfalvlgdpteeapilhlrlsefvrdl
    kpphrynhgtpfadlqikermprrtdkmalfapyraplmkwaaihevhrpgeereillal
    lgdkegsemvakakeawekaknpvlilgagvlqdtvaaerarllaerkgakvlamtpaan
    argleamgvlpgakgaswdepgalyayygfvppeealkgkrfvvmhlshlhplaeryahv
    vlpaptfyekrghlvnlegrvlplspapiengeaegalqvlallaealgvrppfrlhlea
    qkalkarkvpeamgrlsfrlkelrpkerkgafylrptmwkahqavgkaqeaaraelwahp
    etaraealpegaqvavetpfgrvearvvhredvpkghlylsalgpaaglrvegrvlvpag
    gea
    

    Sequence, based on observed residues (ATOM records): (download)
    >3iam3 (3:)
    mvrvkvndrivevppgtsvmdavfhagydvplfcsekhlspigacrmclvriglpiqwqp
    klaascvtavadgmvvdtlsdvvreaqagmveftllnhpldcptcdkggacelqdrtvey
    glyekyelpvytrfeftrrhvdkhhplspfvildrercihckrcvryfeevpgdevldfi
    ergvhtfigtmdfglpsgfsgnitdicpvgalldltarfrarnwemeetpttcalcpvgc
    gitadtrsgellrirarevpevneiwicdagrfghewadqnrlktplvrkegrlveatwe
    eaflalkeglkeargeevglylahdatleegllaselakalktphldfqgrtaapaslfp
    pasledllqadfalvlgdpteeapilhlrlsefvrdlkpphrynhgtpfadlqikermpr
    rtdkmalfapyraplmkwaaihevhrpgeereillallgdkegsemvakakeawekaknp
    vlilgagvlqdtvaaerarllaerkgakvlamtpaanargleamgvlpgakgaswdepga
    lyayygfvppeealkgkrfvvmhlshlhplaeryahvvlpaptfyekrghlvnlegrvlp
    lspapiengeaegalqvlallaealgvrppfrlhleaqkalkarkvpeamgrlsfrlkel
    rpkerkgafylrptmwkahqavgkaqeaaraelwahpetaraealpegaqvavetpfgrv
    earvvhredvpkghlylsalgpaaglrvegrvlv
    

  • Chain '4':
    Sequence, based on SEQRES records: (download)
    >3iam4 (4:)
    mreefleeipldappeeakelrtevmtlnvgpqhpsthgvlrlmvtlsgeevlevvphig
    ylhtgfektmehrtylqnitytprmdylhsfahdlayalavekllgavvppraetirvil
    nelsrlashlvflgtglldlgaltpffyafreretildlfewvtgqrfhhnyiriggvke
    dlpeefvpelkkllevlphrideyealfaespifyerargvgvippevaidlgltggslr
    asgvnydvrkaypysgyetytfdvplgergdvfdrmlvriremresvkiikqalerlepg
    pvrdpnpqitppprhlletsmeaviyhfkhytegfhppkgevyvptesargelgyyivsd
    ggsmpyrvkvrapsfvnlqslpyackgeqvpdmvaiiasldpvmgdvdr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3iam4 (4:)
    vmtlnvggvlrlmvtlsgeevlevvphigylhtgfektmehrtylqnitytprmdylhsf
    ahdlayalavekllgavvppraetirvilnelsrlashlvflgtglldlgaltpffyafr
    eretildlfewvtgqrfhhnyiriggvkedlpeefvpelkkllevlphrideyealfaes
    pifyerargvgvippevaidlgltggslrasgvnydvrkaypysgyetytfdvplgergd
    vfdrmlvriremresvkiikqalerlepgpvrdpnpqitppprhlletsmeaviyhfkhy
    tegfhppkgevyvptesargelgyyivsdggsmpyrvkvrapsfvnlqslpyackgeqvp
    dmvaiiasldpvmgdvdr
    

  • Chain '5':
    Sequence, based on SEQRES records: (download)
    >3iam5 (5:)
    mrlervleearakgypiednglgnlwvvlprerfkeemahykamgfnfladivgldylty
    pdprperfavvyelvslpgwkdgdgsrffvrvyvpeedprlptvtdlwgsanflerevyd
    lfgivfeghpdlrkiltpedleghplrkdyplgetptlfregryiipaefraaltgkdpg
    ltfykggsrkgyrslwadlkkarevkg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3iam5 (5:)
    mrlervleearakgypiednglgnlwvvlprerfkeemahykamgfnfladivgldylty
    pdprperfavvyelvslpgwkdgdgsrffvrvyvpeedprlptvtdlwgsanflerevyd
    lfgivfeghpdlrkiltpedleghplrkdyplgetptlfregryiipaefraaltgkdpg
    ltfykggsrkgyrslw
    

  • Chain '6':
    Sequence, based on SEQRES records: (download)
    >3iam6 (6:)
    malkdlferdvqeleregilfttleklvawgrsnslwpatfglaccaiemmastdarndl
    arfgsevfrasprqadvmivagrlskkmapvmrrvweqmpdpkwvismgacassggmfnn
    yaivqnvdsvvpvdvyvpgcpprpealiyavmqlqkkvrgqaynergerlppvaawkrtr
    g
    

    Sequence, based on observed residues (ATOM records): (download)
    >3iam6 (6:)
    eregilfttleklvawgrsnslwpatfglaccaiemmastdaqadvmivagrlskkmapv
    mrrvweqmpdpkwvismgacassggmfnnyaivqnvdsvvpvdvyvpgcpprpealiyav
    mqlqkkvrgqaynergerlppvaa
    

  • Chain '7':
    Sequence, based on SEQRES records: (download)
    >3iam7 (7:)
    msasserelyeawvellswmreyaqakgvrfekeadfpdfiyrmerpydlpttimtasls
    dglgepflladvsprhaklkriglrlprahihlhahyepgkglvtgkipltkerffalad
    rarealafa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3iam7 (7:)
    asserelyeawvellswmreyaqakgvrfekeadfpdfiyrmerpydlpttimtaslsdg
    lgepflladvsprhaklkriglrlprahihlhahyepgkglvtgkipltkerffaladra
    realafa
    

  • Chain '9':
    Sequence, based on SEQRES records: (download)
    >3iam9 (9:)
    mtlkalaqslgitlkylfskpvtvpypdapvalkprfhgrhvltrhpnglekcigcslca
    aacpayaiyvepaendpenpvsageryakvyeinmlrcifcglceeacptgaivlgydfe
    madyeysdlvygkedmlvdvvgtkpqrreakrtgkpvkvgyvvpyvrpelegfkaptegg
    kr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3iam9 (9:)
    ypdapvalkprfhgrhvltrhpnglekcigcslcaaacpayaiyvepaendpenpvsage
    ryakvyeinmlrcifcglceeacptgaivlgydfemadyeysdlvygkedmlvdvvgtkp
    qrreakrtgkpvkvgyvvpyvrpelegfkapteg
    

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3iamA (A:)
    mtgpilsgldprfertlyahvgkegswtldyylrhggyetakrvlkektpdevieevkrs
    glrgrggagfptglkwsfmpkddgkqhylicnadesepgsfkdryiledvphlliegmil
    agyairatvgyiyvrgeyrraadrleqaikearargylgknlfgtdfsfdlhvhrgagay
    icgeetalmnsleglranprlkppfpaqsglwgkpttinnvetlasvvpimergadwfaq
    mgteqskgmklyqisgpvkrpgvyelpmgttfreliyewaggplepiqaiipggsstppl
    pfteevldtpmsyehlqakgsmlgtggvilipervsmvdamwnltrfyahescgkctpcr
    egvagfmvnlfakigtgqgeekdvenleallpliegrsfcpladaavwpvkgslrhfkdq
    ylalarekrpvprpslwr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3iamA (A:)
    tgpilsgldprfertlyahvgkegswtldyylrhggyetakrvlkektpdevieevkrsg
    lrgrggagfptglkwsfmpkddgkqhylicnadesepgsfkdryiledvphlliegmila
    gyairatvgyiyvrgeyrraadrleqaikearargylgknlfgtdfsfdlhvhrgagayi
    cgeetalmnsleglranprlkppfpaqsglwgkpttinnvetlasvvpimergadwfaqm
    gteqskgmklyqisgpvkrpgvyelpmgttfreliyewaggplepiqaiipggsstpplp
    fteevldtpmsyehlqakgsmlgtggvilipervsmvdamwnltrfyahescgkctpcre
    gvagfmvnlfakigtgqgeekdvenleallpliegrsfcpladaavwpvkgslrhfkdqy
    lalarekrpvprpslwr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3iamB (B:)
    mgffddkqdfleetfakyppegrraaimpllrrvqqeegwirperieeiarlvgttptev
    mgvasfysyyqfvptgkyhlqvcatlscklagaeelwdyltetlgigpgevtpdglfsvq
    kveclgschtapviqvndepyvecvtrarleallaglragkrleeielpgkcghhvheve
    v
    

    Sequence, based on observed residues (ATOM records): (download)
    >3iamB (B:)
    gffddkqdfleetfakyppegrraaimpllrrvqqeegwirperieeiarlvgttptevm
    gvasfysyyqfvptgkyhlqvcatlscklagaeelwdyltetlgigpgevtpdglfsvqk
    veclgschtapviqvndepyvecvtrarleallaglragkrleeielpgkcghhvheve
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3iamC (C:)
    mvrvkvndrivevppgtsvmdavfhagydvplfcsekhlspigacrmclvriglpkkgpd
    gkpllnekgepeiqwqpklaascvtavadgmvvdtlsdvvreaqagmveftllnhpldcp
    tcdkggacelqdrtveyglyekyyqkgplelpvytrfeftrrhvdkhhplspfvildrer
    cihckrcvryfeevpgdevldfiergvhtfigtmdfglpsgfsgnitdicpvgalldlta
    rfrarnwemeetpttcalcpvgcgitadtrsgellrirarevpevneiwicdagrfghew
    adqnrlktplvrkegrlveatweeaflalkeglkeargeevglylahdatleegllasel
    akalktphldfqgrtaapaslfppasledllqadfalvlgdpteeapilhlrlsefvrdl
    kpphrynhgtpfadlqikermprrtdkmalfapyraplmkwaaihevhrpgeereillal
    lgdkegsemvakakeawekaknpvlilgagvlqdtvaaerarllaerkgakvlamtpaan
    argleamgvlpgakgaswdepgalyayygfvppeealkgkrfvvmhlshlhplaeryahv
    vlpaptfyekrghlvnlegrvlplspapiengeaegalqvlallaealgvrppfrlhlea
    qkalkarkvpeamgrlsfrlkelrpkerkgafylrptmwkahqavgkaqeaaraelwahp
    etaraealpegaqvavetpfgrvearvvhredvpkghlylsalgpaaglrvegrvlvpag
    gea
    

    Sequence, based on observed residues (ATOM records): (download)
    >3iamC (C:)
    mvrvkvndrivevppgtsvmdavfhagydvplfcsekhlspigacrmclvriglpiqwqp
    klaascvtavadgmvvdtlsdvvreaqagmveftllnhpldcptcdkggacelqdrtvey
    glyekyelpvytrfeftrrhvdkhhplspfvildrercihckrcvryfeevpgdevldfi
    ergvhtfigtmdfglpsgfsgnitdicpvgalldltarfrarnwemeetpttcalcpvgc
    gitadtrsgellrirarevpevneiwicdagrfghewadqnrlktplvrkegrlveatwe
    eaflalkeglkeargeevglylahdatleegllaselakalktphldfqgrtaapaslfp
    pasledllqadfalvlgdpteeapilhlrlsefvrdlkpphrynhgtpfadlqikermpr
    rtdkmalfapyraplmkwaaihevhrpgeereillallgdkegsemvakakeawekaknp
    vlilgagvlqdtvaaerarllaerkgakvlamtpaanargleamgvlpgakgaswdepga
    lyayygfvppeealkgkrfvvmhlshlhplaeryahvvlpaptfyekrghlvnlegrvlp
    lspapiengeaegalqvlallaealgvrppfrlhleaqkalkarkvpeamgrlsfrlkel
    rpkerkgafylrptmwkahqavgkaqeaaraelwahpetaraealpegaqvavetpfgrv
    earvvhredvpkghlylsalgpaaglrvegrvlv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3iamD (D:)
    mreefleeipldappeeakelrtevmtlnvgpqhpsthgvlrlmvtlsgeevlevvphig
    ylhtgfektmehrtylqnitytprmdylhsfahdlayalavekllgavvppraetirvil
    nelsrlashlvflgtglldlgaltpffyafreretildlfewvtgqrfhhnyiriggvke
    dlpeefvpelkkllevlphrideyealfaespifyerargvgvippevaidlgltggslr
    asgvnydvrkaypysgyetytfdvplgergdvfdrmlvriremresvkiikqalerlepg
    pvrdpnpqitppprhlletsmeaviyhfkhytegfhppkgevyvptesargelgyyivsd
    ggsmpyrvkvrapsfvnlqslpyackgeqvpdmvaiiasldpvmgdvdr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3iamD (D:)
    vmtlnvggvlrlmvtlsgeevlevvphigylhtgfektmehrtylqnitytprmdylhsf
    ahdlayalavekllgavvppraetirvilnelsrlashlvflgtglldlgaltpffyafr
    eretildlfewvtgqrfhhnyiriggvkedlpeefvpelkkllevlphrideyealfaes
    pifyerargvgvippevaidlgltggslrasgvnydvrkaypysgyetytfdvplgergd
    vfdrmlvriremresvkiikqalerlepgpvrdpnpqitppprhlletsmeaviyhfkhy
    tegfhppkgevyvptesargelgyyivsdggsmpyrvkvrapsfvnlqslpyackgeqvp
    dmvaiiasldpvmgdvdr
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3iamE (E:)
    mrlervleearakgypiednglgnlwvvlprerfkeemahykamgfnfladivgldylty
    pdprperfavvyelvslpgwkdgdgsrffvrvyvpeedprlptvtdlwgsanflerevyd
    lfgivfeghpdlrkiltpedleghplrkdyplgetptlfregryiipaefraaltgkdpg
    ltfykggsrkgyrslwadlkkarevkg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3iamE (E:)
    mrlervleearakgypiednglgnlwvvlprerfkeemahykamgfnfladivgldylty
    pdprperfavvyelvslpgwkdgdgsrffvrvyvpeedprlptvtdlwgsanflerevyd
    lfgivfeghpdlrkiltpedleghplrkdyplgetptlfregryiipaefraaltgkdpg
    ltfykggsrkgyrslw
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3iamF (F:)
    malkdlferdvqeleregilfttleklvawgrsnslwpatfglaccaiemmastdarndl
    arfgsevfrasprqadvmivagrlskkmapvmrrvweqmpdpkwvismgacassggmfnn
    yaivqnvdsvvpvdvyvpgcpprpealiyavmqlqkkvrgqaynergerlppvaawkrtr
    g
    

    Sequence, based on observed residues (ATOM records): (download)
    >3iamF (F:)
    eregilfttleklvawgrsnslwpatfglaccaiemmastdaqadvmivagrlskkmapv
    mrrvweqmpdpkwvismgacassggmfnnyaivqnvdsvvpvdvyvpgcpprpealiyav
    mqlqkkvrgqaynergerlppvaa
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3iamG (G:)
    mtlkalaqslgitlkylfskpvtvpypdapvalkprfhgrhvltrhpnglekcigcslca
    aacpayaiyvepaendpenpvsageryakvyeinmlrcifcglceeacptgaivlgydfe
    madyeysdlvygkedmlvdvvgtkpqrreakrtgkpvkvgyvvpyvrpelegfkaptegg
    kr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3iamG (G:)
    ypdapvalkprfhgrhvltrhpnglekcigcslcaaacpayaiyvepaendpenpvsage
    ryakvyeinmlrcifcglceeacptgaivlgydfemadyeysdlvygkedmlvdvvgtkp
    qrreakrtgkpvkvgyvvpyvrpelegfkapteg
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3iamH (H:)
    msasserelyeawvellswmreyaqakgvrfekeadfpdfiyrmerpydlpttimtasls
    dglgepflladvsprhaklkriglrlprahihlhahyepgkglvtgkipltkerffalad
    rarealafa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3iamH (H:)
    asserelyeawvellswmreyaqakgvrfekeadfpdfiyrmerpydlpttimtaslsdg
    lgepflladvsprhaklkriglrlprahihlhahyepgkglvtgkipltkerffaladra
    realafa