PDB entry 3i9v

View 3i9v on RCSB PDB site
Description: Crystal structure of the hydrophilic domain of respiratory complex I from Thermus thermophilus, oxidized, 2 mol/ASU
Class: oxidoreductase
Keywords: OXIDOREDUCTASE, ELECTRON TRANSPORT, RESPIRATORY CHAIN, Cell membrane, Flavoprotein, FMN, Iron, Iron-sulfur, Membrane, Metal-binding, NAD, Quinone, Disulfide bond, Transport
Deposited on 2009-07-13, released 2009-09-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.236
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '1':
    Compound: NADH-quinone oxidoreductase subunit 1
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3i9v11, d3i9v12, d3i9v13
  • Chain '2':
    Compound: NADH-quinone oxidoreductase subunit 2
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3i9v2_
  • Chain '3':
    Compound: NADH-quinone oxidoreductase subunit 3
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3i9v31, d3i9v32, d3i9v33, d3i9v34
  • Chain '4':
    Compound: NADH-quinone oxidoreductase subunit 4
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3i9v4_
  • Chain '5':
    Compound: NADH-quinone oxidoreductase subunit 5
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3i9v5_
  • Chain '6':
    Compound: NADH-quinone oxidoreductase subunit 6
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3i9v6_
  • Chain '7':
    Compound: NADH-quinone oxidoreductase subunit 15
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3i9v7_
  • Chain '9':
    Compound: NADH-quinone oxidoreductase subunit 9
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3i9v9_
  • Chain 'A':
    Compound: NADH-quinone oxidoreductase subunit 1
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3i9va1, d3i9va2, d3i9va3
  • Chain 'B':
    Compound: NADH-quinone oxidoreductase subunit 2
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3i9vb_
  • Chain 'C':
    Compound: NADH-quinone oxidoreductase subunit 3
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3i9vc1, d3i9vc2, d3i9vc3, d3i9vc4
  • Chain 'D':
    Compound: NADH-quinone oxidoreductase subunit 4
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3i9vd_
  • Chain 'E':
    Compound: NADH-quinone oxidoreductase subunit 5
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3i9ve_
  • Chain 'F':
    Compound: NADH-quinone oxidoreductase subunit 6
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3i9vf_
  • Chain 'G':
    Compound: NADH-quinone oxidoreductase subunit 9
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3i9vg_
  • Chain 'H':
    Compound: NADH-quinone oxidoreductase subunit 15
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3i9vh_
  • Heterogens: SF4, FES, FMN, MN, CA

PDB Chain Sequences:

  • Chain '1':
    Sequence, based on SEQRES records: (download)
    >3i9v1 (1:)
    mtgpilsgldprfertlyahvgkegswtldyylrhggyetakrvlkektpdevieevkrs
    glrgrggagfptglkwsfmpkddgkqhylicnadesepgsfkdryiledvphlliegmil
    agyairatvgyiyvrgeyrraadrleqaikearargylgknlfgtdfsfdlhvhrgagay
    icgeetalmnsleglranprlkppfpaqsglwgkpttinnvetlasvvpimergadwfaq
    mgteqskgmklyqisgpvkrpgvyelpmgttfreliyewaggplepiqaiipggsstppl
    pfteevldtpmsyehlqakgsmlgtggvilipervsmvdamwnltrfyahescgkctpcr
    egvagfmvnlfakigtgqgeekdvenleallpliegrsfcpladaavwpvkgslrhfkdq
    ylalarekrpvprpslwr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3i9v1 (1:)
    tgpilsgldprfertlyahvgkegswtldyylrhggyetakrvlkektpdevieevkrsg
    lrgrggagfptglkwsfmpkddgkqhylicnadesepgsfkdryiledvphlliegmila
    gyairatvgyiyvrgeyrraadrleqaikearargylgknlfgtdfsfdlhvhrgagayi
    cgeetalmnsleglranprlkppfpaqsglwgkpttinnvetlasvvpimergadwfaqm
    gteqskgmklyqisgpvkrpgvyelpmgttfreliyewaggplepiqaiipggsstpplp
    fteevldtpmsyehlqakgsmlgtggvilipervsmvdamwnltrfyahescgkctpcre
    gvagfmvnlfakigtgqgeekdvenleallpliegrsfcpladaavwpvkgslrhfkdqy
    lalarekrpvprpslwr
    

  • Chain '2':
    Sequence, based on SEQRES records: (download)
    >3i9v2 (2:)
    mgffddkqdfleetfakyppegrraaimpllrrvqqeegwirperieeiarlvgttptev
    mgvasfysyyqfvptgkyhlqvcatlscklagaeelwdyltetlgigpgevtpdglfsvq
    kveclgschtapviqvndepyvecvtrarleallaglragkrleeielpgkcghhvheve
    v
    

    Sequence, based on observed residues (ATOM records): (download)
    >3i9v2 (2:)
    ffddkqdfleetfakyppegrraaimpllrrvqqeegwirperieeiarlvgttptevmg
    vasfysyyqfvptgkyhlqvcatlscklagaeelwdyltetlgigpgevtpdglfsvqkv
    eclgschtapviqvndepyvecvtrarleallaglragkrleeielpgkcghhvheve
    

  • Chain '3':
    Sequence, based on SEQRES records: (download)
    >3i9v3 (3:)
    mvrvkvndrivevppgtsvmdavfhagydvplfcsekhlspigacrmclvriglpkkgpd
    gkpllnekgepeiqwqpklaascvtavadgmvvdtlsdvvreaqagmveftllnhpldcp
    tcdkggacelqdrtveyglyekyyqkgplelpvytrfeftrrhvdkhhplspfvildrer
    cihckrcvryfeevpgdevldfiergvhtfigtmdfglpsgfsgnitdicpvgalldlta
    rfrarnwemeetpttcalcpvgcgitadtrsgellrirarevpevneiwicdagrfghew
    adqnrlktplvrkegrlveatweeaflalkeglkeargeevglylahdatleegllasel
    akalktphldfqgrtaapaslfppasledllqadfalvlgdpteeapilhlrlsefvrdl
    kpphrynhgtpfadlqikermprrtdkmalfapyraplmkwaaihevhrpgeereillal
    lgdkegsemvakakeawekaknpvlilgagvlqdtvaaerarllaerkgakvlamtpaan
    argleamgvlpgakgaswdepgalyayygfvppeealkgkrfvvmhlshlhplaeryahv
    vlpaptfyekrghlvnlegrvlplspapiengeaegalqvlallaealgvrppfrlhlea
    qkalkarkvpeamgrlsfrlkelrpkerkgafylrptmwkahqavgkaqeaaraelwahp
    etaraealpegaqvavetpfgrvearvvhredvpkghlylsalgpaaglrvegrvlvpag
    gea
    

    Sequence, based on observed residues (ATOM records): (download)
    >3i9v3 (3:)
    mvrvkvndrivevppgtsvmdavfhagydvplfcsekhlspigacrmclvriglpiqwqp
    klaascvtavadgmvvdtlsdvvreaqagmveftllnhpldcptcdkggacelqdrtvey
    glyekyelpvytrfeftrrhvdkhhplspfvildrercihckrcvryfeevpgdevldfi
    ergvhtfigtmdfglpsgfsgnitdicpvgalldltarfrarnwemeetpttcalcpvgc
    gitadtrsgellrirarevpevneiwicdagrfghewadqnrlktplvrkegrlveatwe
    eaflalkeglkeargeevglylahdatleegllaselakalktphldfqgrtaapaslfp
    pasledllqadfalvlgdpteeapilhlrlsefvrdlkpphrynhgtpfadlqikermpr
    rtdkmalfapyraplmkwaaihevhrpgeereillallgdkegsemvakakeawekaknp
    vlilgagvlqdtvaaerarllaerkgakvlamtpaanargleamgvlpgakgaswdepga
    lyayygfvppeealkgkrfvvmhlshlhplaeryahvvlpaptfyekrghlvnlegrvlp
    lspapiengeaegalqvlallaealgvrppfrlhleaqkalkarkvpeamgrlsfrlkel
    rpkerkgafylrptmwkahqavgkaqeaaraelwahpetaraealpegaqvavetpfgrv
    earvvhredvpkghlylsalgpaaglrvegrvlv
    

  • Chain '4':
    Sequence, based on SEQRES records: (download)
    >3i9v4 (4:)
    mreefleeipldappeeakelrtevmtlnvgpqhpsthgvlrlmvtlsgeevlevvphig
    ylhtgfektmehrtylqnitytprmdylhsfahdlayalavekllgavvppraetirvil
    nelsrlashlvflgtglldlgaltpffyafreretildlfewvtgqrfhhnyiriggvke
    dlpeefvpelkkllevlphrideyealfaespifyerargvgvippevaidlgltggslr
    asgvnydvrkaypysgyetytfdvplgergdvfdrmlvriremresvkiikqalerlepg
    pvrdpnpqitppprhlletsmeaviyhfkhytegfhppkgevyvptesargelgyyivsd
    ggsmpyrvkvrapsfvnlqslpyackgeqvpdmvaiiasldpvmgdvdr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3i9v4 (4:)
    mtlnvggvlrlmvtlsgeevlevvphigylhtgfektmehrtylqnitytprmdylhsfa
    hdlayalavekllgavvppraetirvilnelsrlashlvflgtglldlgaltpffyafre
    retildlfewvtgqrfhhnyiriggvkedlpeefvpelkkllevlphrideyealfaesp
    ifyerargvgvippevaidlgltggslrasgvnydvrkaypysgyetytfdvplgergdv
    fdrmlvriremresvkiikqalerlepgpvrdpnpqitppprhlletsmeaviyhfkhyt
    egfhppkgevyvptesargelgyyivsdggsmpyrvkvrapsfvnlqslpyackgeqvpd
    mvaiiasldpvmgdvdr
    

  • Chain '5':
    Sequence, based on SEQRES records: (download)
    >3i9v5 (5:)
    mrlervleearakgypiednglgnlwvvlprerfkeemahykamgfnfladivgldylty
    pdprperfavvyelvslpgwkdgdgsrffvrvyvpeedprlptvtdlwgsanflerevyd
    lfgivfeghpdlrkiltpedleghplrkdyplgetptlfregryiipaefraaltgkdpg
    ltfykggsrkgyrslwadlkkarevkg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3i9v5 (5:)
    mrlervleearakgypiednglgnlwvvlprerfkeemahykamgfnfladivgldylty
    pdprperfavvyelvslpgwkdgdgsrffvrvyvpeedprlptvtdlwgsanflerevyd
    lfgivfeghpdlrkiltpedleghplrkdyplgetptlfregryiipaefraaltgkdpg
    ltfykggsrkgyrslw
    

  • Chain '6':
    Sequence, based on SEQRES records: (download)
    >3i9v6 (6:)
    malkdlferdvqeleregilfttleklvawgrsnslwpatfglaccaiemmastdarndl
    arfgsevfrasprqadvmivagrlskkmapvmrrvweqmpdpkwvismgacassggmfnn
    yaivqnvdsvvpvdvyvpgcpprpealiyavmqlqkkvrgqaynergerlppvaawkrtr
    g
    

    Sequence, based on observed residues (ATOM records): (download)
    >3i9v6 (6:)
    eregilfttleklvawgrsnslwpatfglaccaiemmastdarqadvmivagrlskkmap
    vmrrvweqmpdpkwvismgacassggmfnnyaivqnvdsvvpvdvyvpgcpprpealiya
    vmqlqkkvrgqaynergerlppvaa
    

  • Chain '7':
    Sequence, based on SEQRES records: (download)
    >3i9v7 (7:)
    msasserelyeawvellswmreyaqakgvrfekeadfpdfiyrmerpydlpttimtasls
    dglgepflladvsprhaklkriglrlprahihlhahyepgkglvtgkipltkerffalad
    rarealafa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3i9v7 (7:)
    asserelyeawvellswmreyaqakgvrfekeadfpdfiyrmerpydlpttimtaslsdg
    lgepflladvsprhaklkriglrlprahihlhahyepgkglvtgkipltkerffaladra
    realafa
    

  • Chain '9':
    Sequence, based on SEQRES records: (download)
    >3i9v9 (9:)
    mtlkalaqslgitlkylfskpvtvpypdapvalkprfhgrhvltrhpnglekcigcslca
    aacpayaiyvepaendpenpvsageryakvyeinmlrcifcglceeacptgaivlgydfe
    madyeysdlvygkedmlvdvvgtkpqrreakrtgkpvkvgyvvpyvrpelegfkaptegg
    kr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3i9v9 (9:)
    ypdapvalkprfhgrhvltrhpnglekcigcslcaaacpayaiyvepaendpenpvsage
    ryakvyeinmlrcifcglceeacptgaivlgydfemadyeysdlvygkedmlvdvvgtkp
    qrreakrtgkpvkvgyvvpyvrpelegfkapteg
    

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3i9vA (A:)
    mtgpilsgldprfertlyahvgkegswtldyylrhggyetakrvlkektpdevieevkrs
    glrgrggagfptglkwsfmpkddgkqhylicnadesepgsfkdryiledvphlliegmil
    agyairatvgyiyvrgeyrraadrleqaikearargylgknlfgtdfsfdlhvhrgagay
    icgeetalmnsleglranprlkppfpaqsglwgkpttinnvetlasvvpimergadwfaq
    mgteqskgmklyqisgpvkrpgvyelpmgttfreliyewaggplepiqaiipggsstppl
    pfteevldtpmsyehlqakgsmlgtggvilipervsmvdamwnltrfyahescgkctpcr
    egvagfmvnlfakigtgqgeekdvenleallpliegrsfcpladaavwpvkgslrhfkdq
    ylalarekrpvprpslwr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3i9vA (A:)
    tgpilsgldprfertlyahvgkegswtldyylrhggyetakrvlkektpdevieevkrsg
    lrgrggagfptglkwsfmpkddgkqhylicnadesepgsfkdryiledvphlliegmila
    gyairatvgyiyvrgeyrraadrleqaikearargylgknlfgtdfsfdlhvhrgagayi
    cgeetalmnsleglranprlkppfpaqsglwgkpttinnvetlasvvpimergadwfaqm
    gteqskgmklyqisgpvkrpgvyelpmgttfreliyewaggplepiqaiipggsstpplp
    fteevldtpmsyehlqakgsmlgtggvilipervsmvdamwnltrfyahescgkctpcre
    gvagfmvnlfakigtgqgeekdvenleallpliegrsfcpladaavwpvkgslrhfkdqy
    lalarekrpvprpslwr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3i9vB (B:)
    mgffddkqdfleetfakyppegrraaimpllrrvqqeegwirperieeiarlvgttptev
    mgvasfysyyqfvptgkyhlqvcatlscklagaeelwdyltetlgigpgevtpdglfsvq
    kveclgschtapviqvndepyvecvtrarleallaglragkrleeielpgkcghhvheve
    v
    

    Sequence, based on observed residues (ATOM records): (download)
    >3i9vB (B:)
    ffddkqdfleetfakyppegrraaimpllrrvqqeegwirperieeiarlvgttptevmg
    vasfysyyqfvptgkyhlqvcatlscklagaeelwdyltetlgigpgevtpdglfsvqkv
    eclgschtapviqvndepyvecvtrarleallaglragkrleeielpgkcghhvheve
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3i9vC (C:)
    mvrvkvndrivevppgtsvmdavfhagydvplfcsekhlspigacrmclvriglpkkgpd
    gkpllnekgepeiqwqpklaascvtavadgmvvdtlsdvvreaqagmveftllnhpldcp
    tcdkggacelqdrtveyglyekyyqkgplelpvytrfeftrrhvdkhhplspfvildrer
    cihckrcvryfeevpgdevldfiergvhtfigtmdfglpsgfsgnitdicpvgalldlta
    rfrarnwemeetpttcalcpvgcgitadtrsgellrirarevpevneiwicdagrfghew
    adqnrlktplvrkegrlveatweeaflalkeglkeargeevglylahdatleegllasel
    akalktphldfqgrtaapaslfppasledllqadfalvlgdpteeapilhlrlsefvrdl
    kpphrynhgtpfadlqikermprrtdkmalfapyraplmkwaaihevhrpgeereillal
    lgdkegsemvakakeawekaknpvlilgagvlqdtvaaerarllaerkgakvlamtpaan
    argleamgvlpgakgaswdepgalyayygfvppeealkgkrfvvmhlshlhplaeryahv
    vlpaptfyekrghlvnlegrvlplspapiengeaegalqvlallaealgvrppfrlhlea
    qkalkarkvpeamgrlsfrlkelrpkerkgafylrptmwkahqavgkaqeaaraelwahp
    etaraealpegaqvavetpfgrvearvvhredvpkghlylsalgpaaglrvegrvlvpag
    gea
    

    Sequence, based on observed residues (ATOM records): (download)
    >3i9vC (C:)
    mvrvkvndrivevppgtsvmdavfhagydvplfcsekhlspigacrmclvriglpiqwqp
    klaascvtavadgmvvdtlsdvvreaqagmveftllnhpldcptcdkggacelqdrtvey
    glyekyelpvytrfeftrrhvdkhhplspfvildrercihckrcvryfeevpgdevldfi
    ergvhtfigtmdfglpsgfsgnitdicpvgalldltarfrarnwemeetpttcalcpvgc
    gitadtrsgellrirarevpevneiwicdagrfghewadqnrlktplvrkegrlveatwe
    eaflalkeglkeargeevglylahdatleegllaselakalktphldfqgrtaapaslfp
    pasledllqadfalvlgdpteeapilhlrlsefvrdlkpphrynhgtpfadlqikermpr
    rtdkmalfapyraplmkwaaihevhrpgeereillallgdkegsemvakakeawekaknp
    vlilgagvlqdtvaaerarllaerkgakvlamtpaanargleamgvlpgakgaswdepga
    lyayygfvppeealkgkrfvvmhlshlhplaeryahvvlpaptfyekrghlvnlegrvlp
    lspapiengeaegalqvlallaealgvrppfrlhleaqkalkarkvpeamgrlsfrlkel
    rpkerkgafylrptmwkahqavgkaqeaaraelwahpetaraealpegaqvavetpfgrv
    earvvhredvpkghlylsalgpaaglrvegrvlv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3i9vD (D:)
    mreefleeipldappeeakelrtevmtlnvgpqhpsthgvlrlmvtlsgeevlevvphig
    ylhtgfektmehrtylqnitytprmdylhsfahdlayalavekllgavvppraetirvil
    nelsrlashlvflgtglldlgaltpffyafreretildlfewvtgqrfhhnyiriggvke
    dlpeefvpelkkllevlphrideyealfaespifyerargvgvippevaidlgltggslr
    asgvnydvrkaypysgyetytfdvplgergdvfdrmlvriremresvkiikqalerlepg
    pvrdpnpqitppprhlletsmeaviyhfkhytegfhppkgevyvptesargelgyyivsd
    ggsmpyrvkvrapsfvnlqslpyackgeqvpdmvaiiasldpvmgdvdr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3i9vD (D:)
    mtlnvggvlrlmvtlsgeevlevvphigylhtgfektmehrtylqnitytprmdylhsfa
    hdlayalavekllgavvppraetirvilnelsrlashlvflgtglldlgaltpffyafre
    retildlfewvtgqrfhhnyiriggvkedlpeefvpelkkllevlphrideyealfaesp
    ifyerargvgvippevaidlgltggslrasgvnydvrkaypysgyetytfdvplgergdv
    fdrmlvriremresvkiikqalerlepgpvrdpnpqitppprhlletsmeaviyhfkhyt
    egfhppkgevyvptesargelgyyivsdggsmpyrvkvrapsfvnlqslpyackgeqvpd
    mvaiiasldpvmgdvdr
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3i9vE (E:)
    mrlervleearakgypiednglgnlwvvlprerfkeemahykamgfnfladivgldylty
    pdprperfavvyelvslpgwkdgdgsrffvrvyvpeedprlptvtdlwgsanflerevyd
    lfgivfeghpdlrkiltpedleghplrkdyplgetptlfregryiipaefraaltgkdpg
    ltfykggsrkgyrslwadlkkarevkg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3i9vE (E:)
    mrlervleearakgypiednglgnlwvvlprerfkeemahykamgfnfladivgldylty
    pdprperfavvyelvslpgwkdgdgsrffvrvyvpeedprlptvtdlwgsanflerevyd
    lfgivfeghpdlrkiltpedleghplrkdyplgetptlfregryiipaefraaltgkdpg
    ltfykggsrkgyrslw
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3i9vF (F:)
    malkdlferdvqeleregilfttleklvawgrsnslwpatfglaccaiemmastdarndl
    arfgsevfrasprqadvmivagrlskkmapvmrrvweqmpdpkwvismgacassggmfnn
    yaivqnvdsvvpvdvyvpgcpprpealiyavmqlqkkvrgqaynergerlppvaawkrtr
    g
    

    Sequence, based on observed residues (ATOM records): (download)
    >3i9vF (F:)
    eregilfttleklvawgrsnslwpatfglaccaiemmastdarqadvmivagrlskkmap
    vmrrvweqmpdpkwvismgacassggmfnnyaivqnvdsvvpvdvyvpgcpprpealiya
    vmqlqkkvrgqaynergerlppvaa
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3i9vG (G:)
    mtlkalaqslgitlkylfskpvtvpypdapvalkprfhgrhvltrhpnglekcigcslca
    aacpayaiyvepaendpenpvsageryakvyeinmlrcifcglceeacptgaivlgydfe
    madyeysdlvygkedmlvdvvgtkpqrreakrtgkpvkvgyvvpyvrpelegfkaptegg
    kr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3i9vG (G:)
    ypdapvalkprfhgrhvltrhpnglekcigcslcaaacpayaiyvepaendpenpvsage
    ryakvyeinmlrcifcglceeacptgaivlgydfemadyeysdlvygkedmlvdvvgtkp
    qrreakrtgkpvkvgyvvpyvrpelegfkapteg
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3i9vH (H:)
    msasserelyeawvellswmreyaqakgvrfekeadfpdfiyrmerpydlpttimtasls
    dglgepflladvsprhaklkriglrlprahihlhahyepgkglvtgkipltkerffalad
    rarealafa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3i9vH (H:)
    asserelyeawvellswmreyaqakgvrfekeadfpdfiyrmerpydlpttimtaslsdg
    lgepflladvsprhaklkriglrlprahihlhahyepgkglvtgkipltkerffaladra
    realafa