PDB entry 3i9g

View 3i9g on RCSB PDB site
Description: Crystal structure of the LT1009 (SONEPCIZUMAB) antibody Fab fragment in complex with sphingosine-1-phosphate
Class: immune system
Keywords: Antibody, Fab, Sphingosine-1-phosphate, Calcium, Immunoglobin, IgG, IMMUNE SYSTEM
Deposited on 2009-07-10, released 2009-09-29
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-11-24, with a file datestamp of 2009-11-20.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.192
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: Sonepcizumab antibody Fab fragment, heavy chain
    Species: Mus musculus [TaxId:10090]
    Gene: IgG1K
    Database cross-references and differences (RAF-indexed):
    • PDB 3I9G (0-221)
  • Chain 'L':
    Compound: Sonepcizumab antibody Fab fragment, light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3I9G (0-212)
    Domains in SCOPe 2.06: d3i9gl1, d3i9gl2
  • Heterogens: CA, MG, S1P, HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3i9gL (L:)
    ettvtqspsflsasvgdrvtitcitttdidddmnwfqqepgkapkllisegnilrpgvps
    rfsssgygtdftltisklqpedfatyyclqsdnlpftfgqgtkleikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrge