PDB entry 3i81

View 3i81 on RCSB PDB site
Description: Crystal structure of insulin-like growth factor 1 receptor (IGF-1R-WT) complex with BMS-754807 [1-(4-((5-cyclopropyl-1H-pyrazol-3-yl)amino)pyrrolo[2,1-f][1,2,4]triazin-2-yl)-N-(6-fluoro-3-pyridinyl)-2-methyl-L-prolinamide]
Class: hormone
Keywords: HORMONE/GROWTH FACTOR, IGF-1R, KINASE DOMAIN, ATP-binding, Disease mutation, Disulfide bond, Kinase, Membrane, Nucleotide-binding, Phosphoprotein, Polymorphism, Receptor, Transferase, Transmembrane, Tyrosine-protein kinase
Deposited on 2009-07-09, released 2009-12-22
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-12-22, with a file datestamp of 2009-12-18.
Experiment type: XRAY
Resolution: 2.08 Å
R-factor: 0.221
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: insulin-like growth factor 1 receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: IGF1R
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d3i81a_
  • Heterogens: EBI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3i81A (A:)
    mvsaadvyvpdewevarekitmsrelgqgsfgmvyegvakgvvkdepetrvaiktvneaa
    smrerieflneasvmkefnchhvvrllgvvsqgqptlvimelmtrgdlksylrslrpeme
    nnpvlappslskmiqmageiadgmaylnankfvhrdlaarncmvaedftvkigdfgmtrd
    iyetdyyrkggkgllpvrwmspeslkdgvfttysdvwsfgvvlweiatlaeqpyqglsne
    qvlrfvmegglldkpdncpdmlfelmrmcwqynpkmrpsfleiissikeemepgfrevsf
    yyseenkmennpvla
    

    Sequence, based on observed residues (ATOM records): (download)
    >3i81A (A:)
    dvyvpdewevarekitmsrelgqgsfgmvyegvakgvvkdepetrvaiktvneaasmrer
    ieflneasvmkefnchhvvrllgvvsqgqptlvimelmtrgdlksylrslrpeennpvla
    ppslskmiqmageiadgmaylnankfvhrdlaarncmvaedftvkigdfgmtrdiyetdy
    yrllpvrwmspeslkdgvfttysdvwsfgvvlweiatlaeqpyqglsneqvlrfvmeggl
    ldkpdncpdmlfelmrmcwqynpkmrpsfleiissikeemepgfrevsfyyseenk