PDB entry 3i7e

View 3i7e on RCSB PDB site
Description: Co-crystal structure of HIV-1 protease bound to a mutant resistant inhibitor UIC-98038
Class: hydrolase
Keywords: AIDS, HIV, HIV prtease, HIV-protease inhibitor, drug design, Aspartic protease, acid protease, Structure based drug design, Aspartyl protease, Hydrolase, Protease
Deposited on 2009-07-08, released 2009-09-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-12-15, with a file datestamp of 2009-12-11.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.216
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hiv-1 protease
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: HIV-1 protease, pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot O38716 (0-98)
      • variant (6)
    Domains in SCOPe 2.07: d3i7ea_
  • Chain 'B':
    Compound: hiv-1 protease
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: HIV-1 protease, pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot O38716 (0-98)
      • variant (6)
    Domains in SCOPe 2.07: d3i7eb_
  • Heterogens: DJR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3i7eA (A:)
    pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
    qipveicghkaigtvlvgptpvniigrnlltqigctlnf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3i7eB (B:)
    pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
    qipveicghkaigtvlvgptpvniigrnlltqigctlnf