PDB entry 3i7e

View 3i7e on RCSB PDB site
Description: Co-crystal structure of HIV-1 protease bound to a mutant resistant inhibitor UIC-98038
Class: hydrolase
Keywords: AIDS, HIV, HIV prtease, HIV-protease inhibitor, drug design, Aspartic protease, acid protease, Structure based drug design, Aspartyl protease, Hydrolase, Protease
Deposited on 2009-07-08, released 2009-09-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-12-15, with a file datestamp of 2009-12-11.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.216
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: hiv-1 protease
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Gene: HIV-1 protease, pol
  Database cross-references and differences (RAF-indexed):
  • Uniprot O38716 (0-98)
    • variant (6)
  Domains in SCOPe 2.08: d3i7ea_
• Chain 'B':
  Compound: hiv-1 protease
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Gene: HIV-1 protease, pol
  Database cross-references and differences (RAF-indexed):
  • Uniprot O38716 (0-98)
    • variant (6)
  Domains in SCOPe 2.08: d3i7eb_
• Heterogens: DJR, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3i7eA (A:)
  pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
  qipveicghkaigtvlvgptpvniigrnlltqigctlnf
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3i7eB (B:)
  pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
  qipveicghkaigtvlvgptpvniigrnlltqigctlnf