PDB entry 3i6t

View 3i6t on RCSB PDB site
Description: Crystal structure of muconate cycloisomerase from Jannaschia sp.
Class: isomerase
Keywords: STRUCTURAL GENOMICS, ISOMERASE, PSI-2, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC
Deposited on 2009-07-07, released 2009-07-21
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.17
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Muconate cycloisomerase
    Species: Jannaschia sp. [TaxId:290400]
    Gene: Jann_1408
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3i6ta1, d3i6ta2
  • Chain 'B':
    Compound: Muconate cycloisomerase
    Species: Jannaschia sp. [TaxId:290400]
    Gene: Jann_1408
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3i6tb1, d3i6tb2
  • Chain 'C':
    Compound: Muconate cycloisomerase
    Species: Jannaschia sp. [TaxId:290400]
    Gene: Jann_1408
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3i6tc1, d3i6tc2
  • Chain 'D':
    Compound: Muconate cycloisomerase
    Species: Jannaschia sp. [TaxId:290400]
    Gene: Jann_1408
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3i6td1
  • Heterogens: K, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3i6tA (A:)
    mslsdqsqiiagftlwhlslpvtarrdhgigsvagavevvvlrlqadsgavgygeaspwv
    vftgsveatyaaldrylrplvlgravgdhaaimedaraavahcteakaaldtalydlrar
    iagvpvwallggrcrdriplscsiadpdfdkdlalmqrlqdddvriiklktgfkdhafdm
    mrlerlradfpafdirvdynqglhhdvalarvrdvatfkptfieqpvkahlrglmarird
    avdvplladesifgpedmaehpeiadgvsikimksggltraqtvarmaaarglsayggdm
    feaglahlagahmiaatpeitlgcefyqatyflcddilaapfpvadghvlvpdtpglgvd
    vdedalarfavareghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3i6tA (A:)
    dqsqiiagftlwhlslpvtgavevvvlrlqadsgavgygeaspwvvftgsveatyaaldr
    ylrplvlgravgdhaaimedaraavahcteakaaldtalydlrariagvpvwallggrcr
    driplscsiadpdfdkdlalmqrlqdddvriiklktgfkdhafdmmrlerlradfpafdi
    rvdynqglhhdvalarvrdvatfkptfieqpvkahlrglmarirdavdvplladesifgp
    edmaehpeiadgvsikimksggltraqtvarmaaarglsayggdmfeaglahlagahmia
    atpeitlgcefyqatyflcddilaapfpvadghvlvpdtpglgvdvdedalarfav
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3i6tB (B:)
    mslsdqsqiiagftlwhlslpvtarrdhgigsvagavevvvlrlqadsgavgygeaspwv
    vftgsveatyaaldrylrplvlgravgdhaaimedaraavahcteakaaldtalydlrar
    iagvpvwallggrcrdriplscsiadpdfdkdlalmqrlqdddvriiklktgfkdhafdm
    mrlerlradfpafdirvdynqglhhdvalarvrdvatfkptfieqpvkahlrglmarird
    avdvplladesifgpedmaehpeiadgvsikimksggltraqtvarmaaarglsayggdm
    feaglahlagahmiaatpeitlgcefyqatyflcddilaapfpvadghvlvpdtpglgvd
    vdedalarfavareghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3i6tB (B:)
    qiiagftlwhlslpvtarrdhgigsvagavevvvlrlqadsgavgygeaspwvvftgsve
    atyaaldrylrplvlgravgdhaaimedaraavahcteakaaldtalydlrariagvpvw
    allggrcrdriplscsiadpdfdkdlalmqrlqdddvriiklktgfkdhafdmmrlerlr
    adfpafdirvdynqglhhdvalarvrdvatfkptfieqpvkahlrglmarirdavdvpll
    adesifgpedmaehpeiadgvsikimksggltraqtvarmaaarglsayggdmfeaglah
    lagahmiaatpeitlgcefyqatyflcddilaapfpvadghvlvpdtpglgvdvdedala
    rfav
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3i6tC (C:)
    mslsdqsqiiagftlwhlslpvtarrdhgigsvagavevvvlrlqadsgavgygeaspwv
    vftgsveatyaaldrylrplvlgravgdhaaimedaraavahcteakaaldtalydlrar
    iagvpvwallggrcrdriplscsiadpdfdkdlalmqrlqdddvriiklktgfkdhafdm
    mrlerlradfpafdirvdynqglhhdvalarvrdvatfkptfieqpvkahlrglmarird
    avdvplladesifgpedmaehpeiadgvsikimksggltraqtvarmaaarglsayggdm
    feaglahlagahmiaatpeitlgcefyqatyflcddilaapfpvadghvlvpdtpglgvd
    vdedalarfavareghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3i6tC (C:)
    qiiagftlwhlslpvtavevvvlrlqadsgavgygeaspwvvftgsveatyaaldrylrp
    lvlgravgdhaaimedaraavahcteakaaldtalydlrariagvpvwallggrcrdrip
    lscsiadpdfdkdlalmqrlqdddvriiklktgfkdhafdmmrlerlradfpafdirvdy
    nqglhhdvalarvrdvatfkptfieqpvkahlrglmarirdavdvplladesifgpedma
    ehpeiadgvsikimksggltraqtvarmaaarglsayggdmfeaglahlagahmiaatpe
    itlgcefyqatyflcddilaapfpvadghvlvpdtpglgvdvdedalarfav
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3i6tD (D:)
    mslsdqsqiiagftlwhlslpvtarrdhgigsvagavevvvlrlqadsgavgygeaspwv
    vftgsveatyaaldrylrplvlgravgdhaaimedaraavahcteakaaldtalydlrar
    iagvpvwallggrcrdriplscsiadpdfdkdlalmqrlqdddvriiklktgfkdhafdm
    mrlerlradfpafdirvdynqglhhdvalarvrdvatfkptfieqpvkahlrglmarird
    avdvplladesifgpedmaehpeiadgvsikimksggltraqtvarmaaarglsayggdm
    feaglahlagahmiaatpeitlgcefyqatyflcddilaapfpvadghvlvpdtpglgvd
    vdedalarfavareghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3i6tD (D:)
    qiiagftlwhlslpvtgavevvvlrlqadsgavgygeaspwvvftgsveatyaaldrylr
    plvlgravgdhaaimedaraavahcteakaaldtalydlrariagvpvwallggrcrdri
    plscsiadpdfdkdlalmqrlqdddvriiklktgfkdhafdmmrlerlradfpafdirvd
    ynqglhhdvalarvrdvatfkptfieqpvkahlrglmarirdavdvplladesifgpedm
    aehpeiadgvsikimksggltraqtvarmaaarglsayggdmfeaglahlagahmiaatp
    eitlgcefyqatyflcddilaapfpvadghvlvpdtpglgvdvdedalarfav