PDB entry 3i6h

View 3i6h on RCSB PDB site
Description: Ribonuclease A by LB nanotemplate method before high X-Ray dose on ESRF ID14-2 beamline
Class: Hydrolase
Keywords: Ribonuclease A, Disulfide bond, Endonuclease, Glycation, Glycoprotein, Hydrolase, Nuclease, Secreted
Deposited on 2009-07-07, released 2010-07-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-07-07, with a file datestamp of 2010-07-02.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.212
AEROSPACI score: 0.7 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribonuclease pancreatic
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3i6ha_
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3i6hA (A:)
    ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
    knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf
    dasv