PDB entry 3i5v

View 3i5v on RCSB PDB site
Description: Crystal structure of beta toxin 275-280 from Staphylococcus aureus
Class: toxin
Keywords: beta toxin, hemolysin, sphingomyelinase, TOXIN
Deposited on 2009-07-06, released 2010-08-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.214
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-hemolysin
    Species: Staphylococcus aureus [TaxId:561307]
    Gene: hlb
    Database cross-references and differences (RAF-indexed):
    • Uniprot A7LAI8 (Start-312)
      • see remark 999 (294-295)
    Domains in SCOPe 2.07: d3i5va_
  • Chain 'B':
    Compound: Beta-hemolysin
    Species: Staphylococcus aureus [TaxId:561307]
    Gene: hlb
    Database cross-references and differences (RAF-indexed):
    • Uniprot A7LAI8 (Start-312)
      • see remark 999 (294-295)
    Domains in SCOPe 2.07: d3i5vb_
  • Chain 'C':
    Compound: Beta-hemolysin
    Species: Staphylococcus aureus [TaxId:561307]
    Gene: hlb
    Database cross-references and differences (RAF-indexed):
    • Uniprot A7LAI8
      • see remark 999 (294-295)
    Domains in SCOPe 2.07: d3i5vc_
  • Chain 'D':
    Compound: Beta-hemolysin
    Species: Staphylococcus aureus [TaxId:561307]
    Gene: hlb
    Database cross-references and differences (RAF-indexed):
    • Uniprot A7LAI8 (Start-312)
      • see remark 999 (294-295)
    Domains in SCOPe 2.07: d3i5vd_
  • Heterogens: DGA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3i5vA (A:)
    mrsshhhhhhssglvprgshmeskkddtdlklvshnvymlstvlypnwgqykradligqs
    syiknndvvifneafdngasdkllsnvkkeypyqtpvlgrsqsgwdktegsysstvaedg
    gvaivskypikekiqhvfksgcgfdndsnkgfvytkiekngknvhvigthtqsedsrcga
    ghdrkiraeqmkeisdfvkkknipkdetvyiggdlnvnkgtpefkdmlknlnvndvlyag
    hnstwdpqsnsiakynypngkpehldyiftdkdhkqpkqlvnevvtekpkpwdvdgyvyn
    dfsdhypikaysk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3i5vA (A:)
    dlklvshnvymlstvlypnwgqykradligqssyiknndvvifneafdngasdkllsnvk
    keypyqtpvlgrsqsgwdktegsysstvaedggvaivskypikekiqhvfksgcgfdnds
    nkgfvytkiekngknvhvigthtqsedsrcgaghdrkiraeqmkeisdfvkkknipkdet
    vyiggdlnvnkgtpefkdmlknlnvndvlyaghnstwdpqsnsiakynypngkpehldyi
    ftdkdhkqpkqlvnevvtekpkpwdvdgyvyndfsdhypikaysk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3i5vB (B:)
    mrsshhhhhhssglvprgshmeskkddtdlklvshnvymlstvlypnwgqykradligqs
    syiknndvvifneafdngasdkllsnvkkeypyqtpvlgrsqsgwdktegsysstvaedg
    gvaivskypikekiqhvfksgcgfdndsnkgfvytkiekngknvhvigthtqsedsrcga
    ghdrkiraeqmkeisdfvkkknipkdetvyiggdlnvnkgtpefkdmlknlnvndvlyag
    hnstwdpqsnsiakynypngkpehldyiftdkdhkqpkqlvnevvtekpkpwdvdgyvyn
    dfsdhypikaysk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3i5vB (B:)
    dlklvshnvymlstvlypnwgqykradligqssyiknndvvifneafdngasdkllsnvk
    keypyqtpvlgrsqsgwdktegsysstvaedggvaivskypikekiqhvfksgcgfdnds
    nkgfvytkiekngknvhvigthtqsedsrcgaghdrkiraeqmkeisdfvkkknipkdet
    vyiggdlnvnkgtpefkdmlknlnvndvlyaghnstwdpqsnsiakynypngkpehldyi
    ftdkdhkqpkqlvnevvtekpkpwdvdgyvyndfsdhypikaysk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3i5vC (C:)
    mrsshhhhhhssglvprgshmeskkddtdlklvshnvymlstvlypnwgqykradligqs
    syiknndvvifneafdngasdkllsnvkkeypyqtpvlgrsqsgwdktegsysstvaedg
    gvaivskypikekiqhvfksgcgfdndsnkgfvytkiekngknvhvigthtqsedsrcga
    ghdrkiraeqmkeisdfvkkknipkdetvyiggdlnvnkgtpefkdmlknlnvndvlyag
    hnstwdpqsnsiakynypngkpehldyiftdkdhkqpkqlvnevvtekpkpwdvdgyvyn
    dfsdhypikaysk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3i5vC (C:)
    dlklvshnvymlstvlypnwgqykradligqssyiknndvvifneafdngasdkllsnvk
    keypyqtpvlgrsqsgwdktegsysstvaedggvaivskypikekiqhvfksgcgfdnds
    nkgfvytkiekngknvhvigthtqsedsrcgaghdrkiraeqmkeisdfvkkknipkdet
    vyiggdlnvnkgtpefkdmlknlnvndvlyaghnstwdpqsnsiakynypngkpehldyi
    ftdkdhkqpkqlvnevvtekpkpwdvdgyvyndfsdhypikays
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3i5vD (D:)
    mrsshhhhhhssglvprgshmeskkddtdlklvshnvymlstvlypnwgqykradligqs
    syiknndvvifneafdngasdkllsnvkkeypyqtpvlgrsqsgwdktegsysstvaedg
    gvaivskypikekiqhvfksgcgfdndsnkgfvytkiekngknvhvigthtqsedsrcga
    ghdrkiraeqmkeisdfvkkknipkdetvyiggdlnvnkgtpefkdmlknlnvndvlyag
    hnstwdpqsnsiakynypngkpehldyiftdkdhkqpkqlvnevvtekpkpwdvdgyvyn
    dfsdhypikaysk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3i5vD (D:)
    dlklvshnvymlstvlypnwgqykradligqssyiknndvvifneafdngasdkllsnvk
    keypyqtpvlgrsqsgwdktegsysstvaedggvaivskypikekiqhvfksgcgfdnds
    nkgfvytkiekngknvhvigthtqsedsrcgaghdrkiraeqmkeisdfvkkknipkdet
    vyiggdlnvnkgtpefkdmlknlnvndvlyaghnstwdpqsnsiakynypngkpehldyi
    ftdkdhkqpkqlvnevvtekpkpwdvdgyvyndfsdhypikaysk