PDB entry 3i5g

View 3i5g on RCSB PDB site
Description: Crystal structure of rigor-like squid myosin S1
Class: contractile protein
Keywords: rigor-like, squid, muscle myosin, contractile protein
Deposited on 2009-07-05, released 2009-07-28
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-02-09, with a file datestamp of 2010-02-05.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.252
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myosin heavy chain isoform A
    Species: Loligo pealei [TaxId:6621]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot O44934 (0-838)
      • conflict (237)
      • conflict (743)
  • Chain 'B':
    Compound: Myosin regulatory light chain LC-2, mantle muscle
    Species: Todarodes pacificus [TaxId:6637]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3i5gb_
  • Chain 'C':
    Compound: Myosin catalytic light chain LC-1, mantle muscle
    Species: Todarodes pacificus [TaxId:6637]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3i5gc_
  • Heterogens: MLI, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3i5gB (B:)
    aeeaprrvklsqrqmqelkeaftmidqdrdgfigmedlkdmfsslgrvppddelnamlke
    cpgqlnftafltlfgekvsgtdpedalrnafsmfdedgqgfipedylkdllenmgdnfsk
    eeiknvwkdaplknkqfnynkmvdikgkaeded
    

    Sequence, based on observed residues (ATOM records): (download)
    >3i5gB (B:)
    rvklsqrqmqelkeaftmidqdrdgfigmedlkdmfsslgrvppddelnamlkecpgqln
    ftafltlfgekvsgtdpedalrnafsmfdedgqgfipedylkdllenmgdnfskeeiknv
    wkdaplknkqfnynkmvdikgkaed
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3i5gC (C:)
    sqltkdeieevrevfdlfdfwdgrdgdvdaakvgdllrclgmnpteaqvhqhggtkkmge
    kaykleeilpiyeemsskdtgtaadefmeafktfdregqglissaeirnvlkmlgerite
    dqcndiftfcdiredidgnikyedlmkkvmagpfpdksd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3i5gC (C:)
    sqltkdeieevrevfdlfdfwdgrdgdvdaakvgdllrclgmnpteaqvhqhggtkkmge
    kaykleeilpiyeemsskdtgtaadefmeafktfdregqglissaeirnvlkmlgerite
    dqcndiftfcdiredidgnikyedlmkkvmagpfpd