PDB entry 3i59

View 3i59 on RCSB PDB site
Description: Crystal structure of MtbCRP in complex with N6-cAMP
Class: DNA binding protein
Keywords: Mycobacterium Tuberculosis, cAMP Receptor Protein, CRP, allosteric mechanism, DNA binding, inhibition, N6-cAMP, Structural Genomics, TB Structural Genomics Consortium, TBSGC, DNA-binding, Transcription, Transcription regulation, DNA BINDING PROTEIN
Deposited on 2009-07-03, released 2009-09-08
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-12-29, with a file datestamp of 2009-12-24.
Experiment type: XRAY
Resolution: 2.29 Å
R-factor: 0.234
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: transcriptional regulator, Crp/Fnr family
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT3777, Rv3676
    Database cross-references and differences (RAF-indexed):
    • Uniprot O69644 (25-End)
      • expression tag (24)
    Domains in SCOPe 2.04: d3i59a1, d3i59a2
  • Chain 'B':
    Compound: transcriptional regulator, Crp/Fnr family
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT3777, Rv3676
    Database cross-references and differences (RAF-indexed):
    • Uniprot O69644 (25-End)
      • expression tag (23-24)
    Domains in SCOPe 2.04: d3i59b1, d3i59b2
  • Heterogens: N6R, CL, N6S, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3i59A (A:)
    mgsshhhhhhssglggtenlyfqshmdeilaragifqgvepsaiaaltkqlqpvdfprgh
    tvfaegepgdrlyiiisgkvkigrrapdgrenlltimgpsdmfgelsifdpgprtssatt
    itevravsmdrdalrswiadrpeiseqllrvlarrlrrtnnnladliftdvpgrvakqll
    qlaqrfgtqeggalrvthdltqeeiaqlvgasretvnkaladfahrgwirlegksvlisd
    serlarrar
    

    Sequence, based on observed residues (ATOM records): (download)
    >3i59A (A:)
    hmdeilaragifqgvepsqlqpvdfprghtvfaegepgdrlyiiisgkvkigrrapdenl
    ltimgpsdmfgelsifdpgprtssattitevravsmdrdalrswiadrpeiseqllrvla
    rrlrrtnnnladliftdvpgrvakqllqlaqrfgtqeggalrvthdltqeeiaqlvgasr
    etvnkaladfahrgwirlegksvlisdserlarra
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3i59B (B:)
    mgsshhhhhhssglggtenlyfqshmdeilaragifqgvepsaiaaltkqlqpvdfprgh
    tvfaegepgdrlyiiisgkvkigrrapdgrenlltimgpsdmfgelsifdpgprtssatt
    itevravsmdrdalrswiadrpeiseqllrvlarrlrrtnnnladliftdvpgrvakqll
    qlaqrfgtqeggalrvthdltqeeiaqlvgasretvnkaladfahrgwirlegksvlisd
    serlarrar
    

    Sequence, based on observed residues (ATOM records): (download)
    >3i59B (B:)
    shmdeilaragifqgvetkqlqpvdfprghtvfaegepgdrlyiiisgkvkigrrapdgr
    enlltimgpsdmfgelsifdpgprtssattitevravsmdrdalrswiadrpeiseqllr
    vlarrlrrtnnnladldvpgrvakqllqlaqrfgtlrvthdltqeeiaqlvgasretvnk
    aladfahrgwirlegksvlisd