PDB entry 3i54

View 3i54 on RCSB PDB site
Description: Crystal structure of MtbCRP in complex with cAMP
Class: DNA binding protein
Keywords: Mycobacterium tuberculosis, cAMP Receptor Protein, allosteric mechanism, DNA binding, inhibition, Structural Genomics, TB Structural Genomics Consortium, TBSGC, DNA-binding, Transcription, Transcription regulation, DNA BINDING PROTEIN
Deposited on 2009-07-03, released 2009-09-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: transcriptional regulator, Crp/Fnr family
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT3777, Rv3676
    Database cross-references and differences (RAF-indexed):
    • Uniprot O69644 (25-End)
      • expression tag (19-24)
    Domains in SCOPe 2.07: d3i54a1, d3i54a2
  • Chain 'B':
    Compound: transcriptional regulator, Crp/Fnr family
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT3777, Rv3676
    Database cross-references and differences (RAF-indexed):
    • Uniprot O69644 (25-End)
      • expression tag (18-24)
    Domains in SCOPe 2.07: d3i54b1, d3i54b2, d3i54b3
  • Chain 'C':
    Compound: transcriptional regulator, Crp/Fnr family
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT3777, Rv3676
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3i54c1, d3i54c2
  • Chain 'D':
    Compound: transcriptional regulator, Crp/Fnr family
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT3777, Rv3676
    Database cross-references and differences (RAF-indexed):
    • Uniprot O69644 (25-End)
      • expression tag (20-24)
    Domains in SCOPe 2.07: d3i54d1, d3i54d2, d3i54d3
  • Heterogens: CMP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3i54A (A:)
    mgsshhhhhhssglggtenlyfqshmdeilaragifqgvepsaiaaltkqlqpvdfprgh
    tvfaegepgdrlyiiisgkvkigrrapdgrenlltimgpsdmfgelsifdpgprtssatt
    itevravsmdrdalrswiadrpeiseqllrvlarrlrrtnnnladliftdvpgrvakqll
    qlaqrfgtqeggalrvthdltqeeiaqlvgasretvnkaladfahrgwirlegksvlisd
    serlarrar
    

    Sequence, based on observed residues (ATOM records): (download)
    >3i54A (A:)
    lyfqshmdeilaragifqgvepsaiaaqpvdfprghtvfaegepgdrlyiiisgkvkigr
    rapdgrenlltimgpsdmfgelsifdpgprtssattitevravsmdrdalrswiadrpei
    seqllrvlarrlrrtnnnladliftdvpgrvakqllqlaqrfgtqeggalrvthdltqee
    iaqlvgasretvnkaladfahrgwirlegksvlisdserlarra
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3i54B (B:)
    mgsshhhhhhssglggtenlyfqshmdeilaragifqgvepsaiaaltkqlqpvdfprgh
    tvfaegepgdrlyiiisgkvkigrrapdgrenlltimgpsdmfgelsifdpgprtssatt
    itevravsmdrdalrswiadrpeiseqllrvlarrlrrtnnnladliftdvpgrvakqll
    qlaqrfgtqeggalrvthdltqeeiaqlvgasretvnkaladfahrgwirlegksvlisd
    serlarrar
    

    Sequence, based on observed residues (ATOM records): (download)
    >3i54B (B:)
    nlyfqshmdeilaragifqepsaiaallqpvdfprghtvfaegepgdrlyiiisgkvkig
    rrnlltimgpsdmfgelsifdpgprtssattitevravsmdrdalrswiadrpeiseqll
    rvlarrlrrtnnnladliftdvpgrvakqllqlaqrfgtqeggalrvthdltqeeiaqlv
    gasretvnkaladfahrgwirlegksvlisdserlarra
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3i54C (C:)
    mgsshhhhhhssglggtenlyfqshmdeilaragifqgvepsaiaaltkqlqpvdfprgh
    tvfaegepgdrlyiiisgkvkigrrapdgrenlltimgpsdmfgelsifdpgprtssatt
    itevravsmdrdalrswiadrpeiseqllrvlarrlrrtnnnladliftdvpgrvakqll
    qlaqrfgtqeggalrvthdltqeeiaqlvgasretvnkaladfahrgwirlegksvlisd
    serlarrar
    

    Sequence, based on observed residues (ATOM records): (download)
    >3i54C (C:)
    aiaaltkqlqpvdfprghtvfaegepgdrlyiiisgkvkigrrapdgrenlltimgpsdm
    fgelsifdpgprtssattitevravsmdrdalrswiadrpeiseqllrvlarrlrrtnnn
    ladliftdvpgrvakqllqlaqrfgtqeggalrvthdltqeeiaqlvgasretvnkalad
    fahrgwirlegksvlisdserlarra
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3i54D (D:)
    mgsshhhhhhssglggtenlyfqshmdeilaragifqgvepsaiaaltkqlqpvdfprgh
    tvfaegepgdrlyiiisgkvkigrrapdgrenlltimgpsdmfgelsifdpgprtssatt
    itevravsmdrdalrswiadrpeiseqllrvlarrlrrtnnnladliftdvpgrvakqll
    qlaqrfgtqeggalrvthdltqeeiaqlvgasretvnkaladfahrgwirlegksvlisd
    serlarrar
    

    Sequence, based on observed residues (ATOM records): (download)
    >3i54D (D:)
    yfqshmdeilaragifqgvepsaiaaltkqlqpvdfprghtvfaegepgdrlyiiisgkv
    kigrrapdgrenlltimgpsdmfgelsifdpgprtssattitevravsmdrdalrswiad
    rpeiseqllrvlarrlrrtnnnladliftdvpgrvakqllqlaqrfgtqeggalrvthdl
    tqeeiaqlvgasretvnkaladfahrgwirlegksvlisdserlarra