PDB entry 3i50

View 3i50 on RCSB PDB site
Description: Crystal structure of the West Nile Virus envelope glycoprotein in complex with the E53 antibody Fab
Class: viral protein/immune system
Keywords: ANTIBODY, FAB, VIRUS, ENVELOPE, IMMUNOGLOBULIN, FUSION LOOP, Disulfide bond, Envelope protein, Membrane, Transmembrane, Virion
Deposited on 2009-07-03, released 2009-10-27
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-10-27, with a file datestamp of 2009-10-23.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.247
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'E':
    Compound: Envelope glycoprotein
    Species: West Nile virus [TaxId:11082]
    Gene: ENVELOPE
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: murine heavy chain (IgG3) of E53 monoclonal antibody Fab
    Species: Mus musculus [TaxId:10090]
    Gene: Heavy chain of E53 antibody
    Database cross-references and differences (RAF-indexed):
    • PDB 3I50 (0-End)
  • Chain 'L':
    Compound: murine kappa light chain of E53 monoclonal antibody Fab
    Species: Mus musculus [TaxId:10090]
    Gene: Light chain of E53 antibody
    Database cross-references and differences (RAF-indexed):
    • PDB 3I50 (0-206)
    Domains in SCOPe 2.04: d3i50l1, d3i50l2

PDB Chain Sequences:

  • Chain 'E':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3i50L (L:)
    qivltrtggimsaspgekvtmtcsasssvsymhwyqqksgtspkiwiyessklasgvpvr
    fsgsgsgtsysltissmeaedvatyycqqwsshpltfgagtklelkradaaptvsifpps
    seqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstltl
    tkdeyerhnsytceathktstspivks