PDB entry 3i48

View 3i48 on RCSB PDB site
Description: Crystal structure of beta toxin from Staphylococcus aureus F277A, P278A mutant with bound magnesium ions
Class: toxin
Keywords: beta toxin, hemolysin, sphingomyelinase, TOXIN
Deposited on 2009-07-01, released 2010-07-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-hemolysin
    Species: Staphylococcus aureus RN4220 [TaxId:561307]
    Gene: hlb
    Database cross-references and differences (RAF-indexed):
    • Uniprot A7LAI8 (Start-316)
      • engineered (296-297)
    Domains in SCOPe 2.07: d3i48a_
  • Chain 'B':
    Compound: Beta-hemolysin
    Species: Staphylococcus aureus RN4220 [TaxId:561307]
    Gene: hlb
    Database cross-references and differences (RAF-indexed):
    • Uniprot A7LAI8 (Start-316)
      • engineered (296-297)
    Domains in SCOPe 2.07: d3i48b_
  • Heterogens: MG, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3i48A (A:)
    mrsshhhhhhssglvprgshmeskkddtdlklvshnvymlstvlypnwgqykradligqs
    syiknndvvifneafdngasdkllsnvkkeypyqtpvlgrsqsgwdktegsysstvaedg
    gvaivskypikekiqhvfksgcgfdndsnkgfvytkiekngknvhvigthtqsedsrcga
    ghdrkiraeqmkeisdfvkkknipkdetvyiggdlnvnkgtpefkdmlknlnvndvlyag
    hnstwdpqsnsiakynypngkpehldyiftdkdhkqpkqlvnevvtekpkpwdvyaaayy
    yvyndfsdhypikaysk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3i48A (A:)
    dtdlklvshnvymlstvlypnwgqykradligqssyiknndvvifneafdngasdkllsn
    vkkeypyqtpvlgrsqsgwdktegsysstvaedggvaivskypikekiqhvfksgcgfdn
    dsnkgfvytkiekngknvhvigthtqsedsrcgaghdrkiraeqmkeisdfvkkknipkd
    etvyiggdlnvnkgtpefkdmlknlnvndvlyaghnstwdpqsnsiakynypngkpehld
    yiftdkdhkqpkqlvnevvtekpkpwdvyaaayyyvyndfsdhypikaysk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3i48B (B:)
    mrsshhhhhhssglvprgshmeskkddtdlklvshnvymlstvlypnwgqykradligqs
    syiknndvvifneafdngasdkllsnvkkeypyqtpvlgrsqsgwdktegsysstvaedg
    gvaivskypikekiqhvfksgcgfdndsnkgfvytkiekngknvhvigthtqsedsrcga
    ghdrkiraeqmkeisdfvkkknipkdetvyiggdlnvnkgtpefkdmlknlnvndvlyag
    hnstwdpqsnsiakynypngkpehldyiftdkdhkqpkqlvnevvtekpkpwdvyaaayy
    yvyndfsdhypikaysk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3i48B (B:)
    tdlklvshnvymlstvlypnwgqykradligqssyiknndvvifneafdngasdkllsnv
    kkeypyqtpvlgrsqsgwdktegsysstvaedggvaivskypikekiqhvfksgcgfdnd
    snkgfvytkiekngknvhvigthtqsedsrcgaghdrkiraeqmkeisdfvkkknipkde
    tvyiggdlnvnkgtpefkdmlknlnvndvlyaghnstwdpqsnsiakynypngkpehldy
    iftdkdhkqpkqlvnevvtekpkpwdvyaaayyyvyndfsdhypikaysk