PDB entry 3i44

View 3i44 on RCSB PDB site
Description: Crystal structure of aldehyde dehydrogenase from bartonella henselae at 2.0A resolution
Class: oxidoreductase
Keywords: BARTONELLA HENSELAE, ALDEHYDE DEHYDROGENASE, Oxidoreductase, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, SSGCID
Deposited on 2009-07-01, released 2009-07-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-07-14, with a file datestamp of 2009-07-10.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.175
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aldehyde dehydrogenase
    Species: Bartonella henselae [TaxId:38323]
    Gene: aldA, BH03830
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6G4G1 (21-496)
      • engineered (241)
    Domains in SCOPe 2.07: d3i44a_
  • Heterogens: NA, UNX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3i44A (A:)
    mahhhhhhmgtleaqtqgpgsmlnkrkfyinglwddpstphdlyvidpsteeacavislg
    strdadkainaakkafqtwkttspherlgfvekileiyekrssdmaktismemgapidma
    lnaqtatgsshirnfikaykefsfqealiegneqailhydaigvvglitpwnwpmnqvtl
    kvipallagctmvlkpseiaplsamlfaeildeaalpsgvfnlingdganvgsylsahpd
    lemisftgstragkdisknasntlkrvclelggkganiifadadidalqrgvrhcfynsg
    qscnaptrmlveqaiydkaiktakdiaektqvgpghqtgnhigpvvskeqydkiqdliqs
    gidegatlvtggtglpmgmergyyvrptvfadvkphmrifreeifgpvlsllpfntedea
    vtlandteygltnyiqsqdrskcrriaaqvrsgmvevnghelpggsyfggvkfsgrareg
    glwgikefldtkaisyw
    

    Sequence, based on observed residues (ATOM records): (download)
    >3i44A (A:)
    mlnkrkfyinglwddpstphdlyvidpsteeacavislgstrdadkainaakkafqtwkt
    tspherlgfvekileiyekrssdmaktismemgapidmalnaqtatgsshirnfikayke
    fsfqealiegneqailhydaigvvglitpwnwpmnqvtlkvipallagctmvlkpseiap
    lsamlfaeildeaalpsgvfnlingdganvgsylsahpdlemisftgstragkdisknas
    ntlkrvclelggkganiifadadidalqrgvrhcfynsgqscnaptrmlveqaiydkaik
    takdiaektqvgpghqtgnhigpvvskeqydkiqdliqsgidegatlvtggtglpmgmer
    gyyvrptvfadvkphmrifreeifgpvlsllpfntedeavtlandteygltnyiqsqdrs
    kcrriaaqvrsgmvevnghelpggsyfggvkfsgraregglwgikefldtkaisyw