PDB entry 3i42

View 3i42 on RCSB PDB site
Description: Structure of response regulator receiver domain (CheY-like) from Methylobacillus flagellatus
Class: Structural Genomics, Unknown function
Keywords: structural genomics, CheY-like, PSI-2, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC, Unknown function
Deposited on 2009-07-01, released 2009-07-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Response regulator receiver domain protein (CheY-like)
    Species: Methylobacillus flagellatus KT [TaxId:265072]
    Gene: Mfla_1736
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q1H0I3 (3-118)
      • expression tag (1-2)
      • expression tag (119)
    Domains in SCOPe 2.07: d3i42a1, d3i42a2, d3i42a3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3i42A (A:)
    mslqqalivedyqaaaetfkellemlgfqadyvmsgtdalhamstrgydavfidlnlpdt
    sglalvkqlralpmektskfvavsgfakndlgkeacelfdfylekpidiaslepilqsie
    ghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3i42A (A:)
    slqqalivedyqaaaetfkellemlgfqadyvmsgtdalhamstrgydavfidlnlpdts
    glalvkqlralpmektskfvavsgfkndlgkeacelfdfylekpidiaslepilqsie