PDB entry 3i3h

View 3i3h on RCSB PDB site
Description: Crystal structure of Bothropstoxin-I crystallized at 291K
Class: toxin
Keywords: Homologue Phospholipase A2, Bothropstoxin-I, BthTX-I_18C, Lys49-PLA2 from Bothrops jararacussu, Snake venom, Antimicrobial, Disulfide bond, Myotoxin, Secreted, TOXIN
Deposited on 2009-06-30, released 2010-08-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2010-08-11, with a file datestamp of 2010-08-06.
Experiment type: XRAY
Resolution: 2.17 Å
R-factor: 0.248
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Phospholipase A2 homolog bothropstoxin-1
  Species: Bothrops jararacussu [TaxId:8726]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q90249 (0-120)
  Domains in SCOPe 2.08: d3i3ha_
• Chain 'B':
  Compound: Phospholipase A2 homolog bothropstoxin-1
  Species: Bothrops jararacussu [TaxId:8726]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q90249 (0-120)
  Domains in SCOPe 2.08: d3i3hb_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3i3hA (A:)
  slfelgkmilqetgknpaksygaygcncgvlgrgkpkdatdrccyvhkccykkltgcdpk
  kdrysyswkdktivcgennpclkelcecdkavaiclrenlgtynkkyryhlkpfckkadp
  c
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3i3hB (B:)
  slfelgkmilqetgknpaksygaygcncgvlgrgkpkdatdrccyvhkccykkltgcdpk
  kdrysyswkdktivcgennpclkelcecdkavaiclrenlgtynkkyryhlkpfckkadp
  c