PDB entry 3i2c

View 3i2c on RCSB PDB site
Description: Crystal structure of anti-IL-23 antibody CNTO4088
Class: immune system
Keywords: IL-23, antibody, Fab, IMMUNE SYSTEM
Deposited on 2009-06-29, released 2009-07-07
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-03-21, with a file datestamp of 2012-03-16.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.198
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: cnto4088 heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3I2C (0-221)
  • Chain 'L':
    Compound: cnto4088 light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3I2C (0-217)
    Domains in SCOPe 2.06: d3i2cl1, d3i2cl2
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3i2cL (L:)
    divltqspaslavslgqratiscrasksvsssaysffhwyqqkpgqppklliylasnlqs
    gvparfsgsgsgtdftlnihpveaedaatyycqhsgelpftfgsgtkleikradaaptvs
    ifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysms
    stltltkdeyerhnsytceathktstspivksfnrnec