PDB entry 3i07

View 3i07 on RCSB PDB site
Description: Crystal structure of a putative organic hydroperoxide resistance protein from Vibrio cholerae O1 biovar eltor str. N16961
Class: oxidoreductase
Keywords: CSGID, Organic hydroperoxide resistance, oxidoreductase,NIAID, Structural Genomics, National Institute for Allergy and Infectious Disease (NIAID), Center for Structural Genomics of Infectious Diseases, OXIDOREDUCTASE
Deposited on 2009-06-24, released 2009-08-11
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.166
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: organic hydroperoxide resistance protein
    Species: Vibrio cholerae O1 biovar El Tor [TaxId:243277]
    Gene: VC_A1006
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3i07a_
  • Chain 'B':
    Compound: organic hydroperoxide resistance protein
    Species: Vibrio cholerae O1 biovar El Tor [TaxId:243277]
    Gene: VC_A1006
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KKU4 (3-147)
      • expression tag (0-2)
    Domains in SCOPe 2.01: d3i07b_
  • Heterogens: GOL, MES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3i07A (A:)
snamrnknmstiyqtsatasagrngvvstedkllelnlsypkemggsgtatnpeqlfavg
yaacfsnailhvareakvalkeapvtatvgigpngqggfalsvalaahialedeqarqlv
tvahqvcpysnavrgnidvqvsvnglal

    Sequence, based on observed residues (ATOM records): (download) 
    >3i07A (A:)
mrnknmstiyqtsatasagrngvvstedkllelnlsypkemggsgtatnpeqlfavgyaa
cfsnailhvareakvalkeapvtatvgigpngqggfalsvalaahialedeqarqlvtva
hqvcpysnavrgnidvqvsvnglal

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3i07B (B:)
snamrnknmstiyqtsatasagrngvvstedkllelnlsypkemggsgtatnpeqlfavg
yaacfsnailhvareakvalkeapvtatvgigpngqggfalsvalaahialedeqarqlv
tvahqvcpysnavrgnidvqvsvnglal