PDB entry 3i02

View 3i02 on RCSB PDB site
Description: Crystal structure of S54-10 antibody in complex with antigen Kdo(2.4)Kdo(2.4)Kdo
Class: immune system
Keywords: antibody, Fab, IgG, carbohydrate, IMMUNE SYSTEM
Deposited on 2009-06-24, released 2010-01-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-02-02, with a file datestamp of 2010-01-29.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.214
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: immunoglobulin light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3I02 (0-218)
    Domains in SCOPe 2.06: d3i02a1, d3i02a2
  • Chain 'B':
    Compound: Immunoglubulin heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3I02 (0-223)
  • Chain 'C':
    Compound: immunoglobulin light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3I02 (0-End)
    Domains in SCOPe 2.06: d3i02c1, d3i02c2
  • Chain 'D':
    Compound: Immunoglubulin heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3I02 (0-End)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3i02A (A:)
    divmtqspsslavsagekvtmsckssqsllnsrtrknylawyqqkpgqspkllifwastr
    esgvpdrftgsgsgtdftltissvqaedlavyyckqsynlrtfgrgtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3i02C (C:)
    divmtqspsslavsagekvtmsckssqsllnsrtrknylawyqqkpgqspkllifwastr
    esgvpdrftgsgsgtdftltissvqaedlavyyckqsynlrtfgrgtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >3i02C (C:)
    divmtqspsslavsagekvtmsckssqsllnsrtrknylawyqqkpgqspkllifwastr
    esgvpdrftgsgsgtdftltissvqaedlavyyckqsynlrtfgrgtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdigvlnswtdqdskdstysmsstltltkderhn
    tceathktstspivks
    

  • Chain 'D':
    No sequence available.