PDB entry 3hzo

View 3hzo on RCSB PDB site
Description: Rv0554 from Mycobacterium tuberculosis - the structure solved from the tetragonal crystal form
Class: hydrolase
Keywords: hydrolase, Oxidoreductase, Peroxidase
Deposited on 2009-06-23, released 2010-06-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-04-29, with a file datestamp of 2015-04-24.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein Rv0554, putative Bromoperoxidase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: bpoC, MT0580, Rv0554
    Database cross-references and differences (RAF-indexed):
    • Uniprot O06420 (32-End)
      • expression tag (17-31)
    Domains in SCOPe 2.06: d3hzoa1, d3hzoa2
  • Chain 'B':
    Compound: protein Rv0554, putative Bromoperoxidase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: bpoC, MT0580, Rv0554
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3hzob_
  • Heterogens: EDO, NA, MLA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3hzoA (A:)
    msyyhhhhhhdydipttenlyfqgamdpefrvinlayddngtgdpvvfiagrggagrtwh
    phqvpaflaagyrcitfdnrgigatenaegfttqtmvadtaalietldiaparvvgvsmg
    afiaqelmvvapelvssavlmatrgrldrarqffnkaeaelydsgvqlpptydararlle
    nfsrktlnddvavgdwiamfsmwpikstpglrcqldcapqtnrlpayrniaapvlvigfa
    ddvvtppylgrevadalpngrylqipdaghlgfferpeavntamlkffasvka
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hzoA (A:)
    enlyfqgamdpefrvinlayddngtgdpvvfiagrggagrtwhphqvpaflaagyrcitf
    dnrgigatenaegfttqtmvadtaalietldiaparvvgvsmgafiaqelmvvapelvss
    avlmatrgrldrarqffnkaeaelydsgvqlpptydararllenfsrktlnddvavgdwi
    amfsmwpikstpglrcqldcapqtnrlpayrniaapvlvigfaddvvtppylgrevadal
    pngrylqipdaghlgfferpeavntamlkffasvk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3hzoB (B:)
    msyyhhhhhhdydipttenlyfqgamdpefrvinlayddngtgdpvvfiagrggagrtwh
    phqvpaflaagyrcitfdnrgigatenaegfttqtmvadtaalietldiaparvvgvsmg
    afiaqelmvvapelvssavlmatrgrldrarqffnkaeaelydsgvqlpptydararlle
    nfsrktlnddvavgdwiamfsmwpikstpglrcqldcapqtnrlpayrniaapvlvigfa
    ddvvtppylgrevadalpngrylqipdaghlgfferpeavntamlkffasvka
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hzoB (B:)
    inlayddngtgdpvvfiagrggagrtwhphqvpaflaagyrcitfdnrgigatenaegft
    tqtmvadtaalietldiaparvvgvsmgafiaqelmvvapelvssavlmatrgrldrarq
    ffnkaeaelydsgvqlpptydararllenfsrktlnddvavgdwiamfsmwpikstpglr
    cqldcapqtnrlpayrniaapvlvigfaddvvtppylgrevadalpngrylqipdaghlg
    fferpeavntamlkffasvka