PDB entry 3hzk

View 3hzk on RCSB PDB site
Description: Crystal structure of S73-2 antibody in complex with antigen Kdo(2.4)Kdo
Class: immune system
Keywords: antibody, Fab, IgG, carbohydrate, IMMUNE SYSTEM
Deposited on 2009-06-23, released 2010-01-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-02-02, with a file datestamp of 2010-01-29.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.217
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: S73-2 Fab (IgG1k) light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3HZK (0-End)
    Domains in SCOPe 2.06: d3hzka1, d3hzka2
  • Chain 'B':
    Compound: S73-2 Fab (IgG1k) heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3HZK (0-225)
  • Heterogens: MG, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3hzkA (A:)
    divmtqspsslavsagekvtmsckssqsllnsrtrknylawyqqkpgqspklliywastr
    esgvpdrftgsgsgtdftltissvqaedlavyyckqsynlrtfgggtklelkradaaptv
    sifppsseqltsggasvvcflnnfypksiavkwkidgserqngvlnswtdqdkkdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hzkA (A:)
    divmtqspsslavsagekvtmsckssqsllnsrtrknylawyqqkpgqspklliywastr
    esgvpdrftgsgsgtdftltissvqaedlavyyckqsynlrtfgggtklelkradaaptv
    sifppsseqltsggasvvcflnnfypksiavkwkidgserqngvlnswtdqdkkdstysm
    sstltltkdeyerhnsytceathktstspivksfnrne
    

  • Chain 'B':
    No sequence available.