PDB entry 3hzf

View 3hzf on RCSB PDB site
Description: Structure of TR-alfa bound to selective thyromimetic GC-1 in C2 space group
Class: transcription
Keywords: NUCLEAR RECEPTOR, LIGAND BINDING DOMAIN, DNA-binding, Metal-binding, Nucleus, Receptor, Transcription, Transcription regulation, Zinc-finger
Deposited on 2009-06-23, released 2009-07-21
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.192
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thyroid hormone receptor, alpha isoform 1 variant
    Species: Homo sapiens [TaxId:9606]
    Gene: THRA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q59FW3 (6-End)
      • expression tag (3-5)
    Domains in SCOPe 2.06: d3hzfa1, d3hzfa2
  • Heterogens: B72, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3hzfA (A:)
    argshmeemirslqqrpeptpeewdlihiateahrstnaqgshwkqrrkflpddigqspi
    vsmpdgdkvdleafseftkiitpaitrvvdfakklpmfselpcedqiillkgccmeimsl
    raavrydpesdtltlsgemavkreqlkngglgvvsdaifelgkslsafnlddtevallqa
    vllmstdrsgllcvdkieksqeayllafehyvnhrkhniphfwpkllmkvtdlrmigach
    asrflhmkvecptelfpplflevfedqev
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hzfA (A:)
    shmeemirslqqrpeptpeewdlihiateahrstnaqgshwkqrrkflpddigqspivsm
    pdgdkvdleafseftkiitpaitrvvdfakklpmfselpcedqiillkgccmeimslraa
    vrydpesdtltlsgemavkreqlkngglgvvsdaifelgkslsafnlddtevallqavll
    mstdrsgllcvdkieksqeayllafehyvnhrkhniphfwpkllmkvtdlrmigachasr
    flhmkvecptelfpplflevfed