PDB entry 3hz2

View 3hz2 on RCSB PDB site
Description: Crystal structure of a betagamma-crystallin from an Archaea
Class: metal binding protein
Keywords: calcium-bound betagamma-crystallin, METAL BINDING PROTEIN
Deposited on 2009-06-23, released 2009-12-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 1.86 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta/gama crystallin family protein
    Species: Methanosarcina acetivorans [TaxId:2214]
    Gene: 1474415
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3hz2a_
  • Chain 'B':
    Compound: Beta/gama crystallin family protein
    Species: Methanosarcina acetivorans [TaxId:2214]
    Gene: 1474415
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3hz2b_
  • Chain 'C':
    Compound: Beta/gama crystallin family protein
    Species: Methanosarcina acetivorans [TaxId:2214]
    Gene: 1474415
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3hz2c_
  • Chain 'D':
    Compound: Beta/gama crystallin family protein
    Species: Methanosarcina acetivorans [TaxId:2214]
    Gene: 1474415
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3hz2d_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3hz2A (A:)
naaevivyehvnfggksfdatsdqpgagdnlndkissikvksgtwrfyeyinyggrywdl
gpgeyssvesagipdnsissfrqi

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3hz2B (B:)
naaevivyehvnfggksfdatsdqpgagdnlndkissikvksgtwrfyeyinyggrywdl
gpgeyssvesagipdnsissfrqi

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3hz2C (C:)
naaevivyehvnfggksfdatsdqpgagdnlndkissikvksgtwrfyeyinyggrywdl
gpgeyssvesagipdnsissfrqi

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3hz2D (D:)
naaevivyehvnfggksfdatsdqpgagdnlndkissikvksgtwrfyeyinyggrywdl
gpgeyssvesagipdnsissfrqi