PDB entry 3hyl

View 3hyl on RCSB PDB site
Description: Crystal Structure of Transketolase from Bacillus anthracis
Class: transferase
Keywords: alpha-beta structure, Structural Genomics, Center for Structural Genomics of Infectious Diseases, CSGID, Transferase
Deposited on 2009-06-22, released 2009-06-30
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.16 Å
R-factor: 0.178
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: transketolase
    Species: Bacillus anthracis [TaxId:261594]
    Gene: BAA_3769, tkt-2, tkt2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3hyla1, d3hyla2, d3hyla3
  • Chain 'B':
    Compound: transketolase
    Species: Bacillus anthracis [TaxId:261594]
    Gene: BAA_3769, tkt-2, tkt2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3hylb1, d3hylb2, d3hylb3
  • Heterogens: GOL, FMT, PEG, MG, CL, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3hylA (A:)
    mhhhhhhssgvdlgtenlyfqsnamshsieqlsintirtlsidaiekansghpgmpmgaa
    pmaytlwtqfmkhnpnnptwfnrdrfvlsaghgsmllysllhlsgydvtmddlknfrqwg
    sktpghpeyghtagvdattgplgqgiatavgmamaerhlaakynrdaynivdhytyaicg
    dgdlmegvsaeasslaahlqlgrlvvlydsndisldgdlnrsfsesvedrykaygwqvir
    vedgndieaiakaieeakadekrptlievrttigfgspnksgksashgsplgveetkltk
    eayawtaeqdfhvaeevyenfrktvqdvgetaqaewntmlgeyaqaypelanelqaamng
    llpegweqnlptyelgskaatrnssgavinaiaesvpsffggsadlagsnktymnnekdf
    trddysgkniwygvrefamgaamngialhgglktyggtffvfsdylrpairlaalmqlpv
    tyvfthdsiavgedgpthepieqlaalrampnvsvirpadgnesvaawrlalestnkpta
    lvltrqdlptlegakddtyekvakgayvvsaskketadvillatgsevslaveaqkalav
    dgvdasvvsmpsmdrfeaqtaeykesvlpkavtkrfaiemgatfgwhryvglegdvlgid
    tfgasapgekimeeygftvenvvrkvkeml
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hylA (A:)
    sieqlsintirtlsidaiekansghpgmpmgaapmaytlwtqfmkhnpnnptwfnrdrfv
    lsaghgsmllysllhlsgydvtmddlknfrqwgsktpghpeyghtagvdattgplgqgia
    tavgmamaerhlaakynrdaynivdhytyaicgdgdlmegvsaeasslaahlqlgrlvvl
    ydsndisldgdlnrsfsesvedrykaygwqvirvedgndieaiakaieeakadekrptli
    evrttigfgspnksgksashgsplgveetkltkeayawtaeqdfhvaeevyenfrktvqd
    vgetaqaewntmlgeyaqaypelanelqaamngllpegweqnlptyelgskaatrnssga
    vinaiaesvpsffggsadlagsnktymnnekdftrddysgkniwygvrefamgaamngia
    lhgglktyggtffvfsdylrpairlaalmqlpvtyvfthdsiavgedgpthepieqlaal
    rampnvsvirpadgnesvaawrlalestnkptalvltrqdlptlegakddtyekvakgay
    vvsaskketadvillatgsevslaveaqkalavdgvdasvvsmpsmdrfeaqtaeykesv
    lpkavtkrfaiemgatfgwhryvglegdvlgidtfgasapgekimeeygftvenvvrkvk
    eml
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3hylB (B:)
    mhhhhhhssgvdlgtenlyfqsnamshsieqlsintirtlsidaiekansghpgmpmgaa
    pmaytlwtqfmkhnpnnptwfnrdrfvlsaghgsmllysllhlsgydvtmddlknfrqwg
    sktpghpeyghtagvdattgplgqgiatavgmamaerhlaakynrdaynivdhytyaicg
    dgdlmegvsaeasslaahlqlgrlvvlydsndisldgdlnrsfsesvedrykaygwqvir
    vedgndieaiakaieeakadekrptlievrttigfgspnksgksashgsplgveetkltk
    eayawtaeqdfhvaeevyenfrktvqdvgetaqaewntmlgeyaqaypelanelqaamng
    llpegweqnlptyelgskaatrnssgavinaiaesvpsffggsadlagsnktymnnekdf
    trddysgkniwygvrefamgaamngialhgglktyggtffvfsdylrpairlaalmqlpv
    tyvfthdsiavgedgpthepieqlaalrampnvsvirpadgnesvaawrlalestnkpta
    lvltrqdlptlegakddtyekvakgayvvsaskketadvillatgsevslaveaqkalav
    dgvdasvvsmpsmdrfeaqtaeykesvlpkavtkrfaiemgatfgwhryvglegdvlgid
    tfgasapgekimeeygftvenvvrkvkeml
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hylB (B:)
    sieqlsintirtlsidaiekansghpgmpmgaapmaytlwtqfmkhnpnnptwfnrdrfv
    lsaghgsmllysllhlsgydvtmddlknfrqwgsktpghpeyghtagvdattgplgqgia
    tavgmamaerhlaakynrdaynivdhytyaicgdgdlmegvsaeasslaahlqlgrlvvl
    ydsndisldgdlnrsfsesvedrykaygwqvirvedgndieaiakaieeakadekrptli
    evrttigfgspnksgksashgsplgveetkltkeayawtaeqdfhvaeevyenfrktvqd
    vgetaqaewntmlgeyaqaypelanelqaamngllpegweqnlptyelgskaatrnssga
    vinaiaesvpsffggsadlagsnktymnnekdftrddysgkniwygvrefamgaamngia
    lhgglktyggtffvfsdylrpairlaalmqlpvtyvfthdsiavgedgpthepieqlaal
    rampnvsvirpadgnesvaawrlalestnkptalvltrqdlptlegakddtyekvakgay
    vvsaskketadvillatgsevslaveaqkalavdgvdasvvsmpsmdrfeaqtaeykesv
    lpkavtkrfaiemgatfgwhryvglegdvlgidtfgasapgekimeeygftvenvvrkvk
    eml