PDB entry 3hyg

View 3hyg on RCSB PDB site
Description: Crystal Structure of the Catalytic Domain of ADAMTS-5 in Complex with an Amino-2-indanol compound
Class: hydrolase
Keywords: alpha/beta structure, central five stranded beta-sheet, Cleavage on pair of basic residues, Disulfide bond, Extracellular matrix, Glycoprotein, Hydrolase, Metal-binding, Metalloprotease, Polymorphism, Protease, Secreted, Zinc, Zymogen
Deposited on 2009-06-22, released 2009-07-07
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-09-15, with a file datestamp of 2009-09-11.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.182
AEROSPACI score: 0.68 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: A disintegrin and metalloproteinase with thrombospondin motifs 5
    Species: Homo sapiens [TaxId:9606]
    Gene: ADAMTS-5, ADAMTS11, ADAMTS5, ADMP2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UNA0 (Start-220)
      • engineered (22)
    Domains in SCOPe 2.04: d3hyga_
  • Chain 'B':
    Compound: A disintegrin and metalloproteinase with thrombospondin motifs 5
    Species: Homo sapiens [TaxId:9606]
    Gene: ADAMTS-5, ADAMTS11, ADAMTS5, ADMP2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UNA0 (Start-220)
      • engineered (22)
    Domains in SCOPe 2.04: d3hygb_
  • Heterogens: ZN, CA, 099, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3hygA (A:)
    masisrarqvelllvadasmarkygrglqhylltlasianrlyshasienhirlavvkvv
    vlgdkdkslevsknaattlknfckwqhqhnqlgddheehydaailftredlcghhscdtl
    gmadvgticsperscavieddglhaaftvaheighllglshddskfceetfgstedkrlm
    ssiltsidaskpwskctsatiteflddghgnclldlprkqi
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hygA (A:)
    srarqvelllvadasmarkygrglqhylltlasianrlyshasienhirlavvkvvvlgd
    kdkslevsknaattlknfckwqhqhnqlgddheehydaailftredlcghhscdtlgmad
    vgticsperscavieddglhaaftvaheighllglshddskfceetfgstedkrlmssil
    tsidaskpwskctsatiteflddghgnclldlprkqi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3hygB (B:)
    masisrarqvelllvadasmarkygrglqhylltlasianrlyshasienhirlavvkvv
    vlgdkdkslevsknaattlknfckwqhqhnqlgddheehydaailftredlcghhscdtl
    gmadvgticsperscavieddglhaaftvaheighllglshddskfceetfgstedkrlm
    ssiltsidaskpwskctsatiteflddghgnclldlprkqi
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hygB (B:)
    srarqvelllvadasmarkygrglqhylltlasianrlyshasienhirlavvkvvvlgd
    kdkslevsknaattlknfckwqhqhnqlgddheehydaailftredlcghhscdtlgmad
    vgticsperscavieddglhaaftvaheighllglshddskfceetfgstedkrlmssil
    tsidaskpwskctsatiteflddghgnclldlprkqi