PDB entry 3hy9

View 3hy9 on RCSB PDB site
Description: Crystal Structure of the Catalytic Domain of ADAMTS-5 in Complex with an Amino-2-indanol compound
Class: hydrolase
Keywords: alpha/beta structure, central five stranded beta-sheet, HYDROLASE
Deposited on 2009-06-22, released 2009-07-07
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-09-15, with a file datestamp of 2009-09-11.
Experiment type: XRAY
Resolution: 2.02 Å
R-factor: 0.163
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Catalytic Domain of ADAMTS-5
    Species: Homo sapiens [TaxId:9606]
    Gene: ADAMTS-5
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UNA0 (Start-220)
      • engineered (22)
    Domains in SCOPe 2.05: d3hy9a_
  • Chain 'B':
    Compound: Catalytic Domain of ADAMTS-5
    Species: Homo sapiens [TaxId:9606]
    Gene: ADAMTS-5
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UNA0 (2-220)
      • expression tag (1)
      • engineered (22)
    Domains in SCOPe 2.05: d3hy9b_
  • Heterogens: ZN, CA, 098, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3hy9A (A:)
    masisrarqvelllvadasmarkygrglqhylltlasianrlyshasienhirlavvkvv
    vlgdkdkslevsknaattlknfckwqhqhnqlgddheehydaailftredlcghhscdtl
    gmadvgticsperscavieddglhaaftvaheighllglshddskfceetfgstedkrlm
    ssiltsidaskpwskctsatiteflddghgnclldlprkqi
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hy9A (A:)
    srarqvelllvadasmarkygrglqhylltlasianrlyshasienhirlavvkvvvlgd
    kdkslevsknaattlknfckwqhqhnqlgddheehydaailftredlcghhscdtlgmad
    vgticsperscavieddglhaaftvaheighllglshddskfceetfgstedkrlmssil
    tsidaskpwskctsatiteflddghgnclldlprkqi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3hy9B (B:)
    masisrarqvelllvadasmarkygrglqhylltlasianrlyshasienhirlavvkvv
    vlgdkdkslevsknaattlknfckwqhqhnqlgddheehydaailftredlcghhscdtl
    gmadvgticsperscavieddglhaaftvaheighllglshddskfceetfgstedkrlm
    ssiltsidaskpwskctsatiteflddghgnclldlprkqi
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hy9B (B:)
    asisrarqvelllvadasmarkygrglqhylltlasianrlyshasienhirlavvkvvv
    lgdkdkslevsknaattlknfckwqhqhnqlgddheehydaailftredlcghhscdtlg
    madvgticsperscavieddglhaaftvaheighllglshddskfceetfgstedkrlms
    siltsidaskpwskctsatiteflddghgnclldlprkqi