PDB entry 3hxo

View 3hxo on RCSB PDB site
Description: Crystal Structure of Von Willebrand Factor (VWF) A1 Domain in Complex with DNA Aptamer ARC1172, an Inhibitor of VWF-Platelet Binding
Class: blood clotting/blood clotting regulator
Keywords: ARC1779, VWF, Platelet Glycoprotein Ib, Aptamer, ARC1772, Blood coagulation, Cell adhesion, Cleavage on pair of basic residues, Disease mutation, Disulfide bond, Extracellular matrix, Glycoprotein, Hemostasis, Isopeptide bond, Secreted, von Willebrand disease, BLOOD CLOTTING-BLOOD CLOTTING REGULATOR COMPLEX
Deposited on 2009-06-21, released 2009-11-17
The last revision prior to the SCOPe 2.05 freeze date was dated 2012-03-21, with a file datestamp of 2012-03-16.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.23
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: von willebrand factor
    Species: Homo sapiens [TaxId:9606]
    Gene: VWF, F8VWF
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3hxoa_
  • Chain 'B':
    Compound: Aptamer ARC1172
    Species: synthetic, synthetic
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3hxoA (A:)
    edisepplhdfycsrlldlvflldgssrlseaefevlkafvvdmmerlrisqkwvrvavv
    eyhdgshayiglkdrkrpselrriasqvkyagsqvastsevlkytlfqifskidrpeasr
    ialllmasqepqrmsrnfvryvqglkkkkvivipvgigphanlkqirliekqapenkafv
    lssvdeleqqrdeivsylcdlapeapppt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hxoA (A:)
    fycsrlldlvflldgssrlseaefevlkafvvdmmerlrisqkwvrvavveyhdgshayi
    glkdrkrpselrriasqvkyagsqvastsevlkytlfqifskidrpeasrialllmasqe
    pqrmsrnfvryvqglkkkkvivipvgigphanlkqirliekqapenkafvlssvdeleqq
    rdeivsylcdlapeapppt
    

  • Chain 'B':
    No sequence available.