PDB entry 3hw8

View 3hw8 on RCSB PDB site
Description: ternary complex of DNA polymerase lambda of a two nucleotide gapped DNA substrate with a C in the scrunch site
Class: transferase/DNA
Keywords: scrunch site, X-family, polymerase, DNA damage, DNA repair, DNA replication, DNA synthesis, DNA-binding, DNA-directed DNA polymerase, Lyase, Manganese, Metal-binding, Nucleotidyltransferase, Nucleus, Phosphoprotein, Polymorphism, Transferase, TRANSFERASE/DNA COMPLEX
Deposited on 2009-06-17, released 2009-08-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-08-25, with a file datestamp of 2009-08-21.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.212
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA polymerase lambda
    Species: Homo sapiens [TaxId:9606]
    Gene: POLL
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UGP5 (Start-334)
      • engineered (302)
    Domains in SCOPe 2.07: d3hw8a1, d3hw8a2, d3hw8a3
  • Chain 'B':
    Compound: 5'-d(*cp*gp*gp*cp*cp*ap*ap*tp*ap*cp*tp*g)-3'
  • Chain 'C':
    Compound: 5'-d(*cp*ap*gp*tp*ap*t)-3'
  • Chain 'D':
    Compound: 5'-d(p*gp*cp*cp*g)-3'
  • Heterogens: MG, NA, D3T, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3hw8A (A:)
    maqpssqkatnhnlhiteklevlakaysvqgdkwralgyakainalksfhkpvtsyqeac
    sipgigkrmaekiieilesghlrkldhisesvpvlelfsniwgagtktaqmwyqqgfrsl
    edirsqaslttqqaiglkhysdflermpreeateieqtvqkaaqafnsgllcvacgsyrr
    gkatcgdvdvlithpdgrshrgifsrlldslrqegfltddlvsqeengqqqkylgvcrlp
    gpgrrhrrldiivvpysefacallyftgsahfnrsmralaktkgmslsehalstavvrnt
    hgakvgpgrvlptptekdvfrllglpyrepaerdw
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hw8A (A:)
    atnhnlhiteklevlakaysvqgdkwralgyakainalksfhkpvtsyqeacsipgigkr
    maekiieilesghlrkldhisesvpvlelfsniwgagtktaqmwyqqgfrsledirsqas
    lttqqaiglkhysdflermpreeateieqtvqkaaqafnsgllcvacgsyrrgkatcgdv
    dvlithpdgrshrgifsrlldslrqegfltddlvsqeengqqqkylgvcrlpgpgrrhrr
    ldiivvpysefacallyftgsahfnrsmralaktkgmslsehalstavvrnthgakvgpg
    rvlptptekdvfrllglpyrepaerdw
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.