PDB entry 3hw7

View 3hw7 on RCSB PDB site
Description: High pressure (0.57 GPa) crystal structure of bovine copper, zinc superoxide dismutase at 2.0 angstroms
Class: oxidoreductase, metal binding protein
Keywords: BOVINE, SUPEROXIDE DISMUTASE, high pressure, flexible electrostatic loop, Antioxidant, Disulfide bond, Metal-binding, Oxidoreductase, METAL BINDING PROTEIN
Deposited on 2009-06-17, released 2010-06-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-04-18, with a file datestamp of 2012-04-13.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.174
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Superoxide dismutase [Cu-Zn]
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3hw7a_
  • Chain 'B':
    Compound: Superoxide dismutase [Cu-Zn]
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3hw7b_
  • Heterogens: CU1, ZN, CU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3hw7A (A:)
atkavcvlkgdgpvqgtihfeakgdtvvvtgsitgltegdhgfhvhqfgdntqgctsagp
hfnplskkhggpkdeerhvgdlgnvtadkngvaivdivdplislsgeysiigrtmvvhek
pddlgrggneestktgnagsrlacgvigiak

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3hw7B (B:)
atkavcvlkgdgpvqgtihfeakgdtvvvtgsitgltegdhgfhvhqfgdntqgctsagp
hfnplskkhggpkdeerhvgdlgnvtadkngvaivdivdplislsgeysiigrtmvvhek
pddlgrggneestktgnagsrlacgvigiak