PDB entry 3hvf

View 3hvf on RCSB PDB site
Description: X-ray crystallographic structure of CTX-M-9 S70G in complex with hydrolyzed benzylpenicillin
Class: hydrolase
Keywords: beta-lactamase, BLSE, CTX-M-9, b-lactam, penicillin, benzylpenicillin, HYDROLASE
Deposited on 2009-06-16, released 2010-05-26
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-11-06, with a file datestamp of 2013-11-01.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.147
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: CTX-M-9 extended-spectrum beta-lactamase
    Species: Escherichia coli [TaxId:562]
    Gene: blaCTX-M-9, blaCTX-M-9a, blaCTX-M-9b
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9L5C8 (0-262)
      • engineered (44)
    Domains in SCOPe 2.06: d3hvfa_
  • Chain 'B':
    Compound: CTX-M-9 extended-spectrum beta-lactamase
    Species: Escherichia coli [TaxId:562]
    Gene: blaCTX-M-9, blaCTX-M-9a, blaCTX-M-9b
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9L5C8 (Start-262)
      • engineered (44)
    Domains in SCOPe 2.06: d3hvfb_
  • Heterogens: PNK, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3hvfA (A:)
    qtsavqqklaalekssggrlgvalidtadntqvlyrgderfpmcgtskvmaaaavlkqse
    tqkqllnqpveikpadlvnynpiaekhvngtmtlaelsaaalqysdntamnkliaqlggp
    ggvtafaraigdetfrldrteptlntaipgdprdtttpramaqtlrqltlghalgetqra
    qlvtwlkgnttgaasiraglptswtagdktgsgdygttndiaviwpqgraplvlvtyftq
    pqqnaesrrdvlasaariiaegl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3hvfB (B:)
    qtsavqqklaalekssggrlgvalidtadntqvlyrgderfpmcgtskvmaaaavlkqse
    tqkqllnqpveikpadlvnynpiaekhvngtmtlaelsaaalqysdntamnkliaqlggp
    ggvtafaraigdetfrldrteptlntaipgdprdtttpramaqtlrqltlghalgetqra
    qlvtwlkgnttgaasiraglptswtagdktgsgdygttndiaviwpqgraplvlvtyftq
    pqqnaesrrdvlasaariiaegl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hvfB (B:)
    tsavqqklaalekssggrlgvalidtadntqvlyrgderfpmcgtskvmaaaavlkqset
    qkqllnqpveikpadlvnynpiaekhvngtmtlaelsaaalqysdntamnkliaqlggpg
    gvtafaraigdetfrldrteptlntaipgdprdtttpramaqtlrqltlghalgetqraq
    lvtwlkgnttgaasiraglptswtagdktgsgdygttndiaviwpqgraplvlvtyftqp
    qqnaesrrdvlasaariiaegl