PDB entry 3hv2

View 3hv2 on RCSB PDB site
Description: Crystal structure of signal receiver domain OF HD domain-containing protein FROM Pseudomonas fluorescens Pf-5
Class: signaling protein
Keywords: response regulator/hd domain protein, psi-2, nysgxrc, structural genomics, protein structure initiative, new york sgx research center for structural genomics, signal recognition, signaling protein
Deposited on 2009-06-15, released 2009-06-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-06-23, with a file datestamp of 2009-06-19.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.164
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Response regulator/HD domain protein
    Species: Pseudomonas fluorescens Pf-5 [TaxId:220664]
    Gene: PFL_4895
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3hv2a_
  • Chain 'B':
    Compound: Response regulator/HD domain protein
    Species: Pseudomonas fluorescens Pf-5 [TaxId:220664]
    Gene: PFL_4895
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3hv2b_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3hv2A (A:)
    mslgelnvatvtrrpeillvdsqevilqrlqqllsplpytlhfardatqalqllasrevd
    lvisaahlpqmdgptllarihqqypsttrilltgdpdlkliakainegeiyrylskpwdd
    qelllalrqalehqhsererlrlqdeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hv2A (A:)
    lnvatvtrrpeillvdsqevilqrlqqllsplpytlhfardatqalqllasrevdlvisa
    ahlpqmdgptllarihqqypsttrilltgdpdlkliakainegeiyrylskpwddqelll
    alrqalehqhsererl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3hv2B (B:)
    mslgelnvatvtrrpeillvdsqevilqrlqqllsplpytlhfardatqalqllasrevd
    lvisaahlpqmdgptllarihqqypsttrilltgdpdlkliakainegeiyrylskpwdd
    qelllalrqalehqhsererlrlqdeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hv2B (B:)
    rrpeillvdsqevilqrlqqllsplpytlhfardatqalqllasrevdlvisaahlpqmd
    gptllarihqqypsttrilltgdpdlkliakainegeiyrylskpwddqelllalrqale
    hqhse