PDB entry 3hu7

View 3hu7 on RCSB PDB site
Description: Structural characterization and binding studies of a plant pathogenesis related protein heamanthin from haemanthus multiflorus reveal its dual inhibitory effects against xylanase and alpha-amylase
Class: protein binding
Keywords: plant pathogenesis related protein, inhibitor, TIM Barrel, PROTEIN BINDING
Deposited on 2009-06-13, released 2010-04-28
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-09-07, with a file datestamp of 2011-09-02.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.154
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Haementhin
    Species: Scadoxus multiflorus [TaxId:82246]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3hu7a_
  • Heterogens: ACT, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3hu7A (A:)
    anldiavywgqnfdersleatcdtgnyayviigflntfgggqtpaldisghspsglepqi
    khcqsknvkvllsiggpkgpysldsrsdandlavylfnnfllppghsenrpfgnavldgi
    dfhiehggpsqyqllanilssfrlagtefaltaapqcvypdpnlgtvinsatfdaiwvqf
    ynnpqcsyssgnaealmnawrewsmkartkkvflgfpahpdaagsgymppekvkfhvfpa
    akksykfggimlwdsywdtvsnfsskilgegw