PDB entry 3ht5

View 3ht5 on RCSB PDB site
Description: Crystal Structure of IlvE a Branched Chain Amino Acid Transaminase from Mycobacterium tuberculosis
Class: transferase
Keywords: TB, transaminase, branched-chain-amino-acids, PLP binding type IV fold, Amino-acid biosynthesis, Aminotransferase, Branched-chain amino acid biosynthesis, Pyridoxal phosphate, Transferase
Deposited on 2009-06-11, released 2009-12-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: branched-chain-amino-acid aminotransferase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: ilvE, MT2266, MTCY190.21c, Rv2210c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ht5a_
  • Heterogens: PMP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ht5A (A:)
    mtsgslqftvlravnpatdaqresmlrepgfgkyhtdhmvsidyaegrgwhnarvipygp
    ieldpsaivlhyaqevfeglkayrwadgsivsfradanaarlrssarrlaipelpdavfi
    eslrqliavdkawvpgaggeealylrpfifatepglgvrpatqyrylliaspagayfkgg
    iapvsvwvsteyvracpggtgaakfggnyaasllaqaeaaengcdqvvwldaverryiee
    mggmniffvlgsggsarlvtpelsgsllpgitrdsllqlaidagfaveerrididewqkk
    aaageitevfacgtaavitpvarvrhgasefriadgqpgevtmalrdtltgiqrgtfadt
    hgwmarlg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ht5A (A:)
    yhtdhmvsidyaegrgwhnarvipygpieldpsaivlhyaqevfeglkayrwadgsivsf
    radanaarlrssarrlaipelpdavfieslrqliavdkawvpgaggeealylrpfifate
    pglgvrpatqyrylliaspagayfkggiapvsvwvsteyvracpggtgaakfggnyaasl
    laqaeaaengcdqvvwldaverryieemggmniffvlgsggsarlvtpelsgsllpgitr
    dsllqlaidagfaveerrididewqkkaaageitevfacgtaavitpvarvrhgasefri
    adgqpgevtmalrdtltgiqrgtfadthgwmarlg