PDB entry 3hsr

View 3hsr on RCSB PDB site
Description: Crystal structure of Staphylococcus aureus protein SarZ in mixed disulfide form
Class: transcription regulator
Keywords: helix-turn-helix, cysteine disulfide, MarR-family transcriptional regulator, DNA-binding, Transcription, Transcription regulation, TRANSCRIPTION REGULATOR
Deposited on 2009-06-10, released 2009-07-07
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.199
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: HTH-type transcriptional regulator sarZ
    Species: Staphylococcus aureus subsp. aureus [TaxId:426430]
    Gene: NWMN_2286
    Database cross-references and differences (RAF-indexed):
    • Uniprot A6QJM6 (4-139)
      • expression tag (3)
    Domains in SCOPe 2.06: d3hsra1, d3hsra2
  • Chain 'B':
    Compound: HTH-type transcriptional regulator sarZ
    Species: Staphylococcus aureus subsp. aureus [TaxId:426430]
    Gene: NWMN_2286
    Database cross-references and differences (RAF-indexed):
    • Uniprot A6QJM6 (4-139)
      • expression tag (0-3)
    Domains in SCOPe 2.06: d3hsrb1, d3hsrb2
  • Chain 'C':
    Compound: HTH-type transcriptional regulator sarZ
    Species: Staphylococcus aureus subsp. aureus [TaxId:426430]
    Gene: NWMN_2286
    Database cross-references and differences (RAF-indexed):
    • Uniprot A6QJM6 (4-139)
      • expression tag (0-3)
    Domains in SCOPe 2.06: d3hsrc1, d3hsrc2
  • Chain 'D':
    Compound: HTH-type transcriptional regulator sarZ
    Species: Staphylococcus aureus subsp. aureus [TaxId:426430]
    Gene: NWMN_2286
    Database cross-references and differences (RAF-indexed):
    • Uniprot A6QJM6 (4-139)
      • expression tag (2-3)
    Domains in SCOPe 2.06: d3hsrd1, d3hsrd2
  • Heterogens: BT6, ACT, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3hsrA (A:)
    gshmylskqlcflfyvsskeiikkytnylkeydltytgyivlmaiendeklnikklgerv
    fldsgtltpllkklekkdyvvrtreekdernlqislteqgkaiksplaeisvkvfnefni
    sereasdiinnlrnfvsknf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hsrA (A:)
    mylskqlcflfyvsskeiikkytnylkeydltytgyivlmaiendeklnikklgervfld
    sgtltpllkklekkdyvvrtrlqislteqgkaiksplaeisvkvfnefnisereasdiin
    nlrnfvsknf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3hsrB (B:)
    gshmylskqlcflfyvsskeiikkytnylkeydltytgyivlmaiendeklnikklgerv
    fldsgtltpllkklekkdyvvrtreekdernlqislteqgkaiksplaeisvkvfnefni
    sereasdiinnlrnfvsknf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hsrB (B:)
    gshmylskqlcflfyvsskeiikkytnylkeydltytgyivlmaiendeklnikklgerv
    fldsgtltpllkklekkdyvvrtrlqislteqgkaiksplaeisvkvfnefnisereasd
    iinnlrnfvsknf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3hsrC (C:)
    gshmylskqlcflfyvsskeiikkytnylkeydltytgyivlmaiendeklnikklgerv
    fldsgtltpllkklekkdyvvrtreekdernlqislteqgkaiksplaeisvkvfnefni
    sereasdiinnlrnfvsknf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hsrC (C:)
    gshmylskqlcflfyvsskeiikkytnylkeydltytgyivlmaiendeklnikklgerv
    fldsgtltpllkklekkdyvvrtrlqislteqgkaiksplaeisvkvfnefnisereasd
    iinnlrnfvsknf
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3hsrD (D:)
    gshmylskqlcflfyvsskeiikkytnylkeydltytgyivlmaiendeklnikklgerv
    fldsgtltpllkklekkdyvvrtreekdernlqislteqgkaiksplaeisvkvfnefni
    sereasdiinnlrnfvsknf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hsrD (D:)
    hmylskqlcflfyvsskeiikkytnylkeydltytgyivlmaiendeklnikklgervfl
    dsgtltpllkklekkdyvvrtlqislteqgkaiksplaeisvkvfnefnisereasdiin
    nlrnfvsknf