PDB entry 3hse

View 3hse on RCSB PDB site
Description: Crystal structure of Staphylococcus aureus protein SarZ in reduced form
Class: transcription regulator
Keywords: helix-turn-helix, MarR-family transcriptional regulator, DNA-binding, Transcription, Transcription regulation, TRANSCRIPTION REGULATOR
Deposited on 2009-06-10, released 2009-07-07
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.286
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: HTH-type transcriptional regulator sarZ
    Species: Staphylococcus aureus subsp. aureus [TaxId:426430]
    Gene: NWMN_2286
    Database cross-references and differences (RAF-indexed):
    • Uniprot A6QJM6 (4-End)
      • expression tag (0-3)
    Domains in SCOPe 2.04: d3hsea_
  • Chain 'B':
    Compound: HTH-type transcriptional regulator sarZ
    Species: Staphylococcus aureus subsp. aureus [TaxId:426430]
    Gene: NWMN_2286
    Database cross-references and differences (RAF-indexed):
    • Uniprot A6QJM6 (4-End)
      • expression tag (1-3)
    Domains in SCOPe 2.04: d3hseb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3hseA (A:)
    gshmylskqlcflfyvsskeiikkytnylkeydltytgyivlmaiendeklnikklgerv
    fldsgtltpllkklekkdyvvrtreekdernlqislteqgkaiksplaeisvkvfnefni
    sereasdiinnlrnfvsknf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hseA (A:)
    gshmylskqlcflfyvsskeiikkytnylkeydltytgyivlmaiendenikklgervfl
    dsgtltpllkklkdyteqgkaiksplaeisvkvfnefnisereasdiinnlrnfvs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3hseB (B:)
    gshmylskqlcflfyvsskeiikkytnylkeydltytgyivlmaiendeklnikklgerv
    fldsgtltpllkklekkdyvvrtreekdernlqislteqgkaiksplaeisvkvfnefni
    sereasdiinnlrnfvsknf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hseB (B:)
    shmylskqlcflfyvsskeiikkytnylkeydltytgyivlmaiendeklnikklgervf
    ldsgtltpllkklekkdyvvteqgkaiksplaeisvkvfnefnisereasdiinnlrnfv
    s