PDB entry 3hsb

View 3hsb on RCSB PDB site
Description: Crystal structure of YmaH (Hfq) from Bacillus subtilis in complex with an RNA aptamer
Class: RNA binding protein/RNA
Keywords: Sm-like motif, Protein-RNA complex, RNA-binding, Stress response, RNA BINDING PROTEIN-RNA COMPLEX
Deposited on 2009-06-10, released 2010-06-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-10-03, with a file datestamp of 2012-09-28.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.214
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Protein hfq
  Species: Bacillus subtilis [TaxId:1423]
  Gene: ymaH
  Database cross-references and differences (RAF-indexed):
  • Uniprot O31796
• Chain 'B':
  Compound: Protein hfq
  Species: Bacillus subtilis [TaxId:1423]
  Gene: ymaH
  Database cross-references and differences (RAF-indexed):
  • Uniprot O31796
• Chain 'C':
  Compound: Protein hfq
  Species: Bacillus subtilis [TaxId:1423]
  Gene: ymaH
  Database cross-references and differences (RAF-indexed):
  • Uniprot O31796
• Chain 'D':
  Compound: Protein hfq
  Species: Bacillus subtilis [TaxId:1423]
  Gene: ymaH
  Database cross-references and differences (RAF-indexed):
  • Uniprot O31796
  Domains in SCOPe 2.06: d3hsbd_
• Chain 'E':
  Compound: Protein hfq
  Species: Bacillus subtilis [TaxId:1423]
  Gene: ymaH
  Database cross-references and differences (RAF-indexed):
  • Uniprot O31796
• Chain 'F':
  Compound: Protein hfq
  Species: Bacillus subtilis [TaxId:1423]
  Gene: ymaH
  Database cross-references and differences (RAF-indexed):
  • Uniprot O31796
• Chain 'X':
  Compound: RNA (5'-r(*ap*gp*ap*gp*ap*gp*a)-3')
  Species: synthetic, synthetic
  
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'D':
  Sequence, based on SEQRES records: (download)
  

  >3hsbD (D:)
  gplgsmkpiniqdqflnqirkentyvtvfllngfqlrgqvkgfdnftvllesegkqqliy
  khaistfapqknvqlele
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >3hsbD (D:)
  niqdqflnqirkentyvtvfllngfqlrgqvkgfdnftvllesegkqqliykhaistfap
  qknvqle
  

  
  
• Chain 'E':
  No sequence available.
  
  
• Chain 'F':
  No sequence available.
  
  
• Chain 'X':
  No sequence available.