PDB entry 3hrm

View 3hrm on RCSB PDB site
Description: Crystal structure of Staphylococcus aureus protein SarZ in sulfenic acid form
Class: transcription regulator
Keywords: helix-turn-helix, cysteine sulfenic acid, MarR-family transcriptional regulator, DNA-binding, Transcription, Transcription regulation, TRANSCRIPTION REGULATOR
Deposited on 2009-06-09, released 2009-07-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: HTH-type transcriptional regulator sarZ
    Species: Staphylococcus aureus subsp. aureus [TaxId:426430]
    Gene: NWMN_2286
    Database cross-references and differences (RAF-indexed):
    • Uniprot A6QJM6 (4-End)
      • expression tag (0-3)
    Domains in SCOPe 2.07: d3hrma1, d3hrma2
  • Chain 'B':
    Compound: HTH-type transcriptional regulator sarZ
    Species: Staphylococcus aureus subsp. aureus [TaxId:426430]
    Gene: NWMN_2286
    Database cross-references and differences (RAF-indexed):
    • Uniprot A6QJM6 (4-End)
      • expression tag (0-3)
    Domains in SCOPe 2.07: d3hrmb1, d3hrmb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3hrmA (A:)
    gshmylskqlcflfyvsskeiikkytnylkeydltytgyivlmaiendeklnikklgerv
    fldsgtltpllkklekkdyvvrtreekdernlqislteqgkaiksplaeisvkvfnefni
    sereasdiinnlrnfvsknf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hrmA (A:)
    gshmylskqlcflfyvsskeiikkytnylkeydltytgyivlmaiendeklnikklgerv
    fldsgtltpllkklekkdyvvrtlqislteqgkaiksplaeisvkvfnefnisereasdi
    innlrnfvskn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3hrmB (B:)
    gshmylskqlcflfyvsskeiikkytnylkeydltytgyivlmaiendeklnikklgerv
    fldsgtltpllkklekkdyvvrtreekdernlqislteqgkaiksplaeisvkvfnefni
    sereasdiinnlrnfvsknf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hrmB (B:)
    gshmylskqlcflfyvsskeiikkytnylkeydltytgyivlmaiendeklnikklgerv
    fldsgtltpllkklekkdyvvrtreernlqislteqgkaiksplaeisvkvfnefniser
    easdiinnlrnfvs