PDB entry 3hre

View 3hre on RCSB PDB site
Description: X-ray crystallographic structure of CTX-M-9 S70G
Class: hydrolase
Keywords: beta-lactamase, BLSE, CTX-M-9, Antibiotic resistance, Hydrolase
Deposited on 2009-06-09, released 2010-06-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: N/A
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: CTX-M-9 extended-spectrum beta-lactamase
    Species: Escherichia coli [TaxId:562]
    Gene: blaCTX-M-9, blaCTX-M-9a, blaCTX-M-9b
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9L5C8 (0-262)
      • engineered (44)
    Domains in SCOPe 2.07: d3hrea_
  • Chain 'B':
    Compound: CTX-M-9 extended-spectrum beta-lactamase
    Species: Escherichia coli [TaxId:562]
    Gene: blaCTX-M-9, blaCTX-M-9a, blaCTX-M-9b
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9L5C8 (Start-262)
      • engineered (44)
    Domains in SCOPe 2.07: d3hreb_
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3hreA (A:)
    qtsavqqklaalekssggrlgvalidtadntqvlyrgderfpmcgtskvmaaaavlkqse
    tqkqllnqpveikpadlvnynpiaekhvngtmtlaelsaaalqysdntamnkliaqlggp
    ggvtafaraigdetfrldrteptlntaipgdprdtttpramaqtlrqltlghalgetqra
    qlvtwlkgnttgaasiraglptswtagdktgsgdygttndiaviwpqgraplvlvtyftq
    pqqnaesrrdvlasaariiaegl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3hreB (B:)
    qtsavqqklaalekssggrlgvalidtadntqvlyrgderfpmcgtskvmaaaavlkqse
    tqkqllnqpveikpadlvnynpiaekhvngtmtlaelsaaalqysdntamnkliaqlggp
    ggvtafaraigdetfrldrteptlntaipgdprdtttpramaqtlrqltlghalgetqra
    qlvtwlkgnttgaasiraglptswtagdktgsgdygttndiaviwpqgraplvlvtyftq
    pqqnaesrrdvlasaariiaegl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hreB (B:)
    avqqklaalekssggrlgvalidtadntqvlyrgderfpmcgtskvmaaaavlkqsetqk
    qllnqpveikpadlvnynpiaekhvngtmtlaelsaaalqysdntamnkliaqlggpggv
    tafaraigdetfrldrteptlntaipgdprdtttpramaqtlrqltlghalgetqraqlv
    twlkgnttgaasiraglptswtagdktgsgdygttndiaviwpqgraplvlvtyftqpqq
    naesrrdvlasaariiaegl