PDB entry 3hr7

View 3hr7 on RCSB PDB site
Description: Crystal structure of the shikimate kinase-sulfate complex from Helicobacter pylori
Class: Transferase
Keywords: three-layer alpha/beta fold, nucleoside monophosphate (NMP) kinase family, Amino-acid biosynthesis, Aromatic amino acid biosynthesis, ATP-binding, Kinase, Magnesium, Metal-binding, Nucleotide-binding, Transferase
Deposited on 2009-06-09, released 2010-06-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-05-30, with a file datestamp of 2012-05-25.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.228
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Shikimate kinase
    Species: HELICOBACTER PYLORI [TaxId:85962]
    Gene: AroK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3hr7a_
  • Chain 'B':
    Compound: Shikimate kinase
    Species: HELICOBACTER PYLORI [TaxId:85962]
    Gene: AroK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3hr7b_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3hr7A (A:)
    hhhhhhmqhlvligfmgsgksslaqelglalklevldtdmiiservglsvreifeelged
    nfrmfeknlidelktlktphvistgggivmhenlkglgttfylkmdfetlikrlnqkere
    krpllnnltqakelfekrqalyeknasfiidargglnnslkqvlqfia
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hr7A (A:)
    mqhlvligfmgsgksslaqelglalklevldtdmiiservglsvreifeelgednfrmfe
    knlidelktlktphvistgggivmhenlkglgttfylkmdfetlikrlnnltqakelfek
    rqalyeknasfiidargglnnslkqvlqfia
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3hr7B (B:)
    hhhhhhmqhlvligfmgsgksslaqelglalklevldtdmiiservglsvreifeelged
    nfrmfeknlidelktlktphvistgggivmhenlkglgttfylkmdfetlikrlnqkere
    krpllnnltqakelfekrqalyeknasfiidargglnnslkqvlqfia
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hr7B (B:)
    mqhlvligfmgsgksslaqelglalklevldtdmiiservglsvreifeelgednfrmfe
    knlidelktlktphvistgggivmhenlkglgttfylkmdfetlikrlnqllnnltqake
    lfekrqalyeknasfiidargglnnslkqvlqfia