PDB entry 3hq8

View 3hq8 on RCSB PDB site
Description: CcpA from G. sulfurreducens S134P/V135K variant
Class: oxidoreductase
Keywords: cytochrome c peroxidase, Oxidoreductase, Peroxidase
Deposited on 2009-06-05, released 2009-09-22
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-11-03, with a file datestamp of 2009-10-30.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.234
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome c551 peroxidase
    Species: Geobacter sulfurreducens [TaxId:35554]
    Gene: ccpA, ccpA-2, GSU2813
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q749D0 (Start-344)
      • engineered (133-134)
    Domains in SCOPe 2.03: d3hq8a1, d3hq8a2
  • Chain 'B':
    Compound: cytochrome c551 peroxidase
    Species: Geobacter sulfurreducens [TaxId:35554]
    Gene: ccpA, ccpA-2, GSU2813
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q749D0 (Start-344)
      • engineered (133-134)
    Domains in SCOPe 2.03: d3hq8b1, d3hq8b2
  • Heterogens: HEM, CA, IMD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3hq8A (A:)
    mkqlsvslailcavatseafaadelqqraqglfkpvpakaptlkgnpaspvkvelgkmly
    fdprlsashliscntchnvglgggdlqatstghgwqkgprnaptvlnsvfntaqfwdgra
    kdlaeqakgpvqapkemnntpdqvvktlnsipdyvalfkkafpgekdpvtfdnmakaiev
    featlitpdspfdqylkgkkkaldgkqtaglklfldkgcvachgglnlggtgyfpfgvve
    kpaenilplgdkgrfavtntakdeyvfrapslrnvaitypyfhsgvvwslkeavavmgsa
    qfgiklsddeseaiaaflgsltgkqpkvvypimpastdatprprl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hq8A (A:)
    adelqqraqglfkpvpakaptlkgnpaspvkvelgkmlyfdprlsashliscntchnvgl
    gggdlqatstghgwqkgprnaptvlnsvfntaqfwdgrakdlaeqakgpvqapkemnntp
    dqvvktlnsipdyvalfkkafpgekdpvtfdnmakaievfeatlitpdspfdqylkgkkk
    aldgkqtaglklfldkgcvachgglnlggtgyfpfgvvekpagrfavtntakdeyvfrap
    slrnvaitypyfhsgvvwslkeavavmgsaqfgiklsddeseaiaaflgsltgkqpkvvy
    pimpastdatprprl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3hq8B (B:)
    mkqlsvslailcavatseafaadelqqraqglfkpvpakaptlkgnpaspvkvelgkmly
    fdprlsashliscntchnvglgggdlqatstghgwqkgprnaptvlnsvfntaqfwdgra
    kdlaeqakgpvqapkemnntpdqvvktlnsipdyvalfkkafpgekdpvtfdnmakaiev
    featlitpdspfdqylkgkkkaldgkqtaglklfldkgcvachgglnlggtgyfpfgvve
    kpaenilplgdkgrfavtntakdeyvfrapslrnvaitypyfhsgvvwslkeavavmgsa
    qfgiklsddeseaiaaflgsltgkqpkvvypimpastdatprprl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hq8B (B:)
    adelqqraqglfkpvpakaptlkgnpaspvkvelgkmlyfdprlsashliscntchnvgl
    gggdlqatstghgwqkgprnaptvlnsvfntaqfwdgrakdlaeqakgpvqapkemnntp
    dqvvktlnsipdyvalfkkafpgekdpvtfdnmakaievfeatlitpdspfdqylkgkkk
    aldgkqtaglklfldkgcvachgglnlggtgyfpfgvvekgrfavtntakdeyvfrapsl
    rnvaitypyfhsgvvwslkeavavmgsaqfgiklsddeseaiaaflgsltgkqpkvvypi
    mpastdatprprl