PDB entry 3hq2

View 3hq2 on RCSB PDB site
Description: BsuCP Crystal Structure
Class: hydrolase
Keywords: Hydrolase, Metal-binding, Metalloprotease, Protease, Zinc
Deposited on 2009-06-05, released 2009-06-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-10-13, with a file datestamp of 2009-10-09.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.188
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bacillus subtilis M32 carboxypeptidase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: BSU22080, ypwA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3hq2a_
  • Chain 'B':
    Compound: Bacillus subtilis M32 carboxypeptidase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: BSU22080, ypwA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3hq2b_
  • Heterogens: ZN, PO4, CL, F, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3hq2A (A:)
    meihtyekeffdllkrishyseavalmhwdsrtgapkngsedraesigqlstdifniqts
    drmkelidvlyerfddlsedtkkavelakkeyeenkkipeaeykeyvilcskaetaweea
    kgksdfslfspyleqliefnkrfitywgyqehpydalldlfepgvtvkvldqlfaelkea
    iiplvkqvtasgnkpdtsfitkafpkekqkelslyflqelgydfdggrldetvhpfattl
    nrgdvrvttrydekdfrtaifgtihecghaiyeqnidealsgtnlsdgasmgihesqslf
    yenfigrnkhfwtpyykkiqeaspvqfkdislddfvraineskpsfirveadeltyplhi
    iiryeiekaifsnevsvedlpslwnqkyqdylgitpqtdaegilqdvhwaggdfgyfpsy
    algymyaaqlkqkmledlpefdallergefhpikqwltekvhihgkrkkpldiikdatge
    elnvrylidylsnkysnlyll
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hq2A (A:)
    tyekeffdllkrishyseavalmhwdsrtgapkngsedraesigqlstdifniqtsdrmk
    elidvlyerfddlsedtkkavelakkeyeenkkipeaeykeyvilcskaetaweeakgks
    dfslfspyleqliefnkrfitywgyqehpydalldlfepgvtvkvldqlfaelkeaiipl
    vkqvtasgnkpdtsfitkafpkekqkelslyflqelgydfdggrldetvhpfattlnrgd
    vrvttrydekdfrtaifgtihecghaiyeqnidealsgtnlsdgasmgihesqslfyenf
    igrnkhfwtpyykkiqeaspvqfkdislddfvraineskpsfirveadeltyplhiiiry
    eiekaifsnevsvedlpslwnqkyqdylgitpqtdaegilqdvhwaggdfgyfpsyalgy
    myaaqlkqkmledlpefdallergefhpikqwltekvhihgkrkkpldiikdatgeelnv
    rylidylsnkysnlyl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3hq2B (B:)
    meihtyekeffdllkrishyseavalmhwdsrtgapkngsedraesigqlstdifniqts
    drmkelidvlyerfddlsedtkkavelakkeyeenkkipeaeykeyvilcskaetaweea
    kgksdfslfspyleqliefnkrfitywgyqehpydalldlfepgvtvkvldqlfaelkea
    iiplvkqvtasgnkpdtsfitkafpkekqkelslyflqelgydfdggrldetvhpfattl
    nrgdvrvttrydekdfrtaifgtihecghaiyeqnidealsgtnlsdgasmgihesqslf
    yenfigrnkhfwtpyykkiqeaspvqfkdislddfvraineskpsfirveadeltyplhi
    iiryeiekaifsnevsvedlpslwnqkyqdylgitpqtdaegilqdvhwaggdfgyfpsy
    algymyaaqlkqkmledlpefdallergefhpikqwltekvhihgkrkkpldiikdatge
    elnvrylidylsnkysnlyll
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hq2B (B:)
    htyekeffdllkrishyseavalmhwdsrtgapkngsedraesigqlstdifniqtsdrm
    kelidvlyerfddlsedtkkavelakkeyeenkkipeaeykeyvilcskaetaweeakgk
    sdfslfspyleqliefnkrfitywgyqehpydalldlfepgvtvkvldqlfaelkeaiip
    lvkqvtasgnkpdtsfitkafpkekqkelslyflqelgydfdggrldetvhpfattlnrg
    dvrvttrydekdfrtaifgtihecghaiyeqnidealsgtnlsdgasmgihesqslfyen
    figrnkhfwtpyykkiqeaspvqfkdislddfvraineskpsfirveadeltyplhiiir
    yeiekaifsnevsvedlpslwnqkyqdylgitpqtdaegilqdvhwaggdfgyfpsyalg
    ymyaaqlkqkmledlpefdallergefhpikqwltekvhihgkrkkpldiikdatgeeln
    vrylidylsnkysnlyl