PDB entry 3hpf

View 3hpf on RCSB PDB site
Description: Crystal structure of the mutant Y90F of divergent galactarate dehydratase from Oceanobacillus iheyensis complexed with Mg and galactarate
Class: isomerase
Keywords: Galactarate dehydratase, galactarate, X-ray structure, Isomerase
Deposited on 2009-06-04, released 2009-12-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-12-22, with a file datestamp of 2009-12-18.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.194
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Muconate cycloisomerase
    Species: Oceanobacillus iheyensis HTE831 [TaxId:221109]
    Gene: OB2843
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8EMJ9 (0-End)
      • engineered (89)
    Domains in SCOPe 2.07: d3hpfa1, d3hpfa2
  • Chain 'B':
    Compound: Muconate cycloisomerase
    Species: Oceanobacillus iheyensis HTE831 [TaxId:221109]
    Gene: OB2843
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8EMJ9 (0-End)
      • engineered (89)
    Domains in SCOPe 2.07: d3hpfb1, d3hpfb2
  • Heterogens: GAE, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3hpfA (A:)
    mkitdlelhavgiprhtgfvnkhvivkihtdegltgigemsdfshlplysvdlhdlkqgl
    lsillgqnpfdlmkinkeltdnfpetmyyfekgsfirngidnalhdlcakyldisvsdfl
    ggrvkekikvcypifrhrfseevesnldvvrqkleqgfdvfrlyvgknldadeeflsrvk
    eefgsrvriksydfshllnwkdahraikrltkydlglemiespaprndfdglyqlrlktd
    ypisehvwsfkqqqemikkdaidifnispvfiggltsakkaayaaevaskdvvlgttqel
    svgtaamahlgcsltninhtsdptgpelyvgdvvknrvtykdgylyapdrsvkglgield
    esllakyqvpdlswdnvtvhqlqdrtadtks
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hpfA (A:)
    mkitdlelhavgiprhtgfvnkhvivkihtdegltgigemsdfshlplysvdlhdlkqgl
    lsillgqnpfdlmkinkeltdnfpetmyyfekgsfirngidnalhdlcakyldisvsdfl
    ggrvkekikvcypifrhrfseevesnldvvrqkleqgfdvfrlyvgknldadeeflsrvk
    eefgsrvriksydfshllnwkdahraikrltkydlglemiespaprndfdglyqlrlktd
    ypisehvwsfkqqqemikkdaidifnispvfiggltsakkaayaaevaskdvvlgttqel
    svgtaamahlgcsltninhtsdptgpelyvgdvvknrvtykdgylyapdrsvkglgield
    esllakyqvpdlswdnvtvhqlqdrta
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3hpfB (B:)
    mkitdlelhavgiprhtgfvnkhvivkihtdegltgigemsdfshlplysvdlhdlkqgl
    lsillgqnpfdlmkinkeltdnfpetmyyfekgsfirngidnalhdlcakyldisvsdfl
    ggrvkekikvcypifrhrfseevesnldvvrqkleqgfdvfrlyvgknldadeeflsrvk
    eefgsrvriksydfshllnwkdahraikrltkydlglemiespaprndfdglyqlrlktd
    ypisehvwsfkqqqemikkdaidifnispvfiggltsakkaayaaevaskdvvlgttqel
    svgtaamahlgcsltninhtsdptgpelyvgdvvknrvtykdgylyapdrsvkglgield
    esllakyqvpdlswdnvtvhqlqdrtadtks
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hpfB (B:)
    mkitdlelhavgiprhtgfvnkhvivkihtdegltgigemsdfshlplysvdlhdlkqgl
    lsillgqnpfdlmkinkeltdnfpetmyyfekgsfirngidnalhdlcakyldisvsdfl
    ggrvkekikvcypifrhrfseevesnldvvrqkleqgfdvfrlyvgknldadeeflsrvk
    eefgsrvriksydfshllnwkdahraikrltkydlglemiespaprndfdglyqlrlktd
    ypisehvwsfkqqqemikkdaidifnispvfiggltsakkaayaaevaskdvvlgttqel
    svgtaamahlgcsltninhtsdptgpelyvgdvvknrvtykdgylyapdrsvkglgield
    esllakyqvpdlswdnvtvhqlqdrta