PDB entry 3hoa

View 3hoa on RCSB PDB site
Description: Crystal structure of the Thermus thermophilus M32 carboxypeptidase
Class: hydrolase
Keywords: proline-rich loop, Carboxypeptidase, Hydrolase
Deposited on 2009-06-01, released 2009-06-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.218
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thermostable carboxypeptidase 1
    Species: Thermus thermophilus HB27 [TaxId:262724]
    Gene: TT_C1715
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3hoaa_
  • Chain 'B':
    Compound: Thermostable carboxypeptidase 1
    Species: Thermus thermophilus HB27 [TaxId:262724]
    Gene: TT_C1715
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3hoab_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3hoaA (A:)
    mtpeaayqnllefqretaylaslgalaawdqrtmipkkghehrarqmaalarllhqrmtd
    prigewlekvegsplvqdplsdaavnvrewrqayeraraiperlavelaqaeseaesfwe
    earprddwrgflpylkrvyaltkekaevlfalppapgdppygelydalldgyepgmrare
    llplfaelkeglkglldrilgsgkrpdtsilhrpypveaqrrfalellsacgydleagrl
    dptahpfeiaigpgdvrittryyedffnagifgtlhemghalyeqglpkehwgtprgdav
    slgvhesqsrtwenlvgrslgfwerffprarevfaslgdvsledfhfavnavepslirve
    adevtynlhilvrlelelalfrgelspedlpeawaekyrdhlgvapkdykdgvmqdvhwa
    gglfgyfptytlgnlyaaqffqkaeaelgpleprfargefqpfldwtrarihaegsrfrp
    rvlvervtgeapsarpflaylekkyaaly
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3hoaB (B:)
    mtpeaayqnllefqretaylaslgalaawdqrtmipkkghehrarqmaalarllhqrmtd
    prigewlekvegsplvqdplsdaavnvrewrqayeraraiperlavelaqaeseaesfwe
    earprddwrgflpylkrvyaltkekaevlfalppapgdppygelydalldgyepgmrare
    llplfaelkeglkglldrilgsgkrpdtsilhrpypveaqrrfalellsacgydleagrl
    dptahpfeiaigpgdvrittryyedffnagifgtlhemghalyeqglpkehwgtprgdav
    slgvhesqsrtwenlvgrslgfwerffprarevfaslgdvsledfhfavnavepslirve
    adevtynlhilvrlelelalfrgelspedlpeawaekyrdhlgvapkdykdgvmqdvhwa
    gglfgyfptytlgnlyaaqffqkaeaelgpleprfargefqpfldwtrarihaegsrfrp
    rvlvervtgeapsarpflaylekkyaaly