PDB entry 3hny

View 3hny on RCSB PDB site
Description: Factor VIII Trp2313-His2315 segment is involved in membrane binding as shown by crystal structure of complex between factor VIII C2 domain and an inhibitor
Class: blood clotting
Keywords: BLOOD CLOTTING, Acute phase, Blood coagulation, Calcium, Disease mutation, Disulfide bond, Glycoprotein, Hemophilia, Metal-binding, Pharmaceutical, Polymorphism, Secreted, Sulfation
Deposited on 2009-06-01, released 2010-01-19
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-04-28, with a file datestamp of 2010-04-23.
Experiment type: XRAY
Resolution: 1.07 Å
R-factor: 0.184
AEROSPACI score: 0.89 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'M':
    Compound: coagulation factor viii
    Species: Homo sapiens [TaxId:9606]
    Gene: F8, F8C
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3hnym_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >3hnyM (M:)
    dlnscsmplgmeskaisdaqitassyftnmfatwspskarlhlqgrsnawrpqvnnpkew
    lqvdfqktmkvtgvttqgvkslltsmyvkeflisssqdghqwtlffqngkvkvfqgnqds
    ftpvvnsldpplltrylrihpqswvhqialrmevlgcea
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hnyM (M:)
    scsmplgmeskaisdaqitassyftnmfatwspskarlhlqgrsnawrpqvnnpkewlqv
    dfqktmkvtgvttqgvkslltsmyvkeflisssqdghqwtlffqngkvkvfqgnqdsftp
    vvnsldpplltrylrihpqswvhqialrmevlgcea