PDB entry 3hn6

View 3hn6 on RCSB PDB site
Description: Crystal structure of glucosamine-6-phosphate deaminase from Borrelia burgdorferi
Class: isomerase
Keywords: NIAID, SSGCID, deCODE, UW, SBRI, Infectious Disease, Lyme disease, non-Hodgkin lymphomas, neuroborreliosis, Allosteric enzyme, Carbohydrate metabolism, Hydrolase, ISOMERASE, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease
Deposited on 2009-05-29, released 2009-06-09
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.188
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glucosamine-6-phosphate deaminase
    Species: Borrelia burgdorferi [TaxId:224326]
    Gene: nagB, BB_0152
    Database cross-references and differences (RAF-indexed):
    • Uniprot O30564 (21-288)
      • expression tag (18-20)
    Domains in SCOPe 2.06: d3hn6a1, d3hn6a2
  • Chain 'B':
    Compound: glucosamine-6-phosphate deaminase
    Species: Borrelia burgdorferi [TaxId:224326]
    Gene: nagB, BB_0152
    Database cross-references and differences (RAF-indexed):
    • Uniprot O30564 (21-End)
      • expression tag (18-20)
    Domains in SCOPe 2.06: d3hn6b1, d3hn6b2
  • Chain 'C':
    Compound: glucosamine-6-phosphate deaminase
    Species: Borrelia burgdorferi [TaxId:224326]
    Gene: nagB, BB_0152
    Database cross-references and differences (RAF-indexed):
    • Uniprot O30564 (21-288)
      • expression tag (18-20)
    Domains in SCOPe 2.06: d3hn6c1, d3hn6c2
  • Chain 'D':
    Compound: glucosamine-6-phosphate deaminase
    Species: Borrelia burgdorferi [TaxId:224326]
    Gene: nagB, BB_0152
    Database cross-references and differences (RAF-indexed):
    • Uniprot O30564 (21-End)
      • expression tag (18-20)
    Domains in SCOPe 2.06: d3hn6d1, d3hn6d2
  • Chain 'E':
    Compound: glucosamine-6-phosphate deaminase
    Species: Borrelia burgdorferi [TaxId:224326]
    Gene: nagB, BB_0152
    Database cross-references and differences (RAF-indexed):
    • Uniprot O30564 (21-End)
      • expression tag (18-20)
    Domains in SCOPe 2.06: d3hn6e1, d3hn6e2
  • Chain 'F':
    Compound: glucosamine-6-phosphate deaminase
    Species: Borrelia burgdorferi [TaxId:224326]
    Gene: nagB, BB_0152
    Database cross-references and differences (RAF-indexed):
    • Uniprot O30564 (21-End)
      • expression tag (18-20)
    Domains in SCOPe 2.06: d3hn6f1, d3hn6f2
  • Heterogens: POP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3hn6A (A:)
    mahhhhhhmgtleaqtqgpgsmrliirptyediskwaanhvaqkinefsptkenpfilgl
    ptgsspigmyknlielnknkkisfqnvitfnmdeyigieenhpesyhsfmwnnffshidi
    kkeninilngnasnlkkeceeyekkiksfggimlfvggigpdghiafnepgssltsrtri
    ktltqdtiiansrffegdvnkvpknaltvgigtimdsqevliivnghnkaralkhaiekg
    vnhmwtisalqlhknaiivsdknatyelkvgtveyfndierknfnndlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hn6A (A:)
    pgsmrliirptyediskwaanhvaqkinefsptkenpfilglptgsspigmyknlielnk
    nkkisfqnvitfnmdeyigieenhpesyhsfmwnnffshidikkeninilngnasnlkke
    ceeyekkiksfggimlfvggigpdghiafnepgssltsrtriktltqdtiiansrffegd
    vnkvpknaltvgigtimdsqevliivnghnkaralkhaiekgvnhmwtisalqlhknaii
    vsdknatyelkvgtveyfndierknfnndlk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3hn6B (B:)
    mahhhhhhmgtleaqtqgpgsmrliirptyediskwaanhvaqkinefsptkenpfilgl
    ptgsspigmyknlielnknkkisfqnvitfnmdeyigieenhpesyhsfmwnnffshidi
    kkeninilngnasnlkkeceeyekkiksfggimlfvggigpdghiafnepgssltsrtri
    ktltqdtiiansrffegdvnkvpknaltvgigtimdsqevliivnghnkaralkhaiekg
    vnhmwtisalqlhknaiivsdknatyelkvgtveyfndierknfnndlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hn6B (B:)
    pgsmrliirptyediskwaanhvaqkinefsptkenpfilglptgsspigmyknlielnk
    nkkisfqnvitfnmdeyigieenhpesyhsfmwnnffshidikkeninilngnasnlkke
    ceeyekkiksfggimlfvggigpdghiafnepgssltsrtriktltqdtiiansrffegd
    vnkvpknaltvgigtimdsqevliivnghnkaralkhaiekgvnhmwtisalqlhknaii
    vsdknatyelkvgtveyfndierknfnndl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3hn6C (C:)
    mahhhhhhmgtleaqtqgpgsmrliirptyediskwaanhvaqkinefsptkenpfilgl
    ptgsspigmyknlielnknkkisfqnvitfnmdeyigieenhpesyhsfmwnnffshidi
    kkeninilngnasnlkkeceeyekkiksfggimlfvggigpdghiafnepgssltsrtri
    ktltqdtiiansrffegdvnkvpknaltvgigtimdsqevliivnghnkaralkhaiekg
    vnhmwtisalqlhknaiivsdknatyelkvgtveyfndierknfnndlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hn6C (C:)
    pgsmrliirptyediskwaanhvaqkinefsptkenpfilglptgsspigmyknlielnk
    nkkisfqnvitfnmdeyigieenhpesyhsfmwnnffshidikkeninilngnasnlkke
    ceeyekkiksfggimlfvggigpdghiafnepgssltsrtriktltqdtiiansrffegd
    vnkvpknaltvgigtimdsqevliivnghnkaralkhaiekgvnhmwtisalqlhknaii
    vsdknatyelkvgtveyfndierknfnndlk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3hn6D (D:)
    mahhhhhhmgtleaqtqgpgsmrliirptyediskwaanhvaqkinefsptkenpfilgl
    ptgsspigmyknlielnknkkisfqnvitfnmdeyigieenhpesyhsfmwnnffshidi
    kkeninilngnasnlkkeceeyekkiksfggimlfvggigpdghiafnepgssltsrtri
    ktltqdtiiansrffegdvnkvpknaltvgigtimdsqevliivnghnkaralkhaiekg
    vnhmwtisalqlhknaiivsdknatyelkvgtveyfndierknfnndlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hn6D (D:)
    pgsmrliirptyediskwaanhvaqkinefsptkenpfilglptgsspigmyknlielnk
    nkkisfqnvitfnmdeyigieenhpesyhsfmwnnffshidikkeninilngnasnlkke
    ceeyekkiksfggimlfvggigpdghiafnepgssltsrtriktltqdtiiansrffegd
    vnkvpknaltvgigtimdsqevliivnghnkaralkhaiekgvnhmwtisalqlhknaii
    vsdknatyelkvgtveyfndierknfnndl
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3hn6E (E:)
    mahhhhhhmgtleaqtqgpgsmrliirptyediskwaanhvaqkinefsptkenpfilgl
    ptgsspigmyknlielnknkkisfqnvitfnmdeyigieenhpesyhsfmwnnffshidi
    kkeninilngnasnlkkeceeyekkiksfggimlfvggigpdghiafnepgssltsrtri
    ktltqdtiiansrffegdvnkvpknaltvgigtimdsqevliivnghnkaralkhaiekg
    vnhmwtisalqlhknaiivsdknatyelkvgtveyfndierknfnndlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hn6E (E:)
    pgsmrliirptyediskwaanhvaqkinefsptkenpfilglptgsspigmyknlielnk
    nkkisfqnvitfnmdeyigieenhpesyhsfmwnnffshidikkeninilngnasnlkke
    ceeyekkiksfggimlfvggigpdghiafnepgssltsrtriktltqdtiiansrffnkv
    pknaltvgigtimdsqevliivnghnkaralkhaiekgvnhmwtisalqlhknaiivsdk
    natyelkvgtveyfndierknfnndl
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3hn6F (F:)
    mahhhhhhmgtleaqtqgpgsmrliirptyediskwaanhvaqkinefsptkenpfilgl
    ptgsspigmyknlielnknkkisfqnvitfnmdeyigieenhpesyhsfmwnnffshidi
    kkeninilngnasnlkkeceeyekkiksfggimlfvggigpdghiafnepgssltsrtri
    ktltqdtiiansrffegdvnkvpknaltvgigtimdsqevliivnghnkaralkhaiekg
    vnhmwtisalqlhknaiivsdknatyelkvgtveyfndierknfnndlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hn6F (F:)
    pgsmrliirptyediskwaanhvaqkinefsptkenpfilglptgsspigmyknlielnk
    nkkisfqnvitfnmdeyigieenhpesyhsfmwnnffshidikkeninilngnasnlkke
    ceeyekkiksfggimlfvggigpdghiafnepgssltsrtriktltqdtiidvnkvpkna
    ltvgigtimdsqevliivnghnkaralkhaiekgvnhmwtisalqlhknaiivsdknaty
    elkvgtveyfndierknfnndl