PDB entry 3hn3

View 3hn3 on RCSB PDB site
Description: Human beta-glucuronidase at 1.7 A resolution
Class: hydrolase
Keywords: LYSOSOMAL ENZYME, ACID HYDROLASE, GLYCOSIDASE, Disease mutation, Glycoprotein, Hydrolase, Lysosome, Mucopolysaccharidosis
Deposited on 2009-05-29, released 2009-12-01
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.205
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-glucuronidase
    Species: Homo sapiens [TaxId:9606]
    Gene: PLACENTAL GUS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3hn3a1, d3hn3a2, d3hn3a3
  • Chain 'B':
    Compound: beta-glucuronidase
    Species: Homo sapiens [TaxId:9606]
    Gene: PLACENTAL GUS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3hn3b1, d3hn3b2, d3hn3b3
  • Chain 'D':
    Compound: beta-glucuronidase
    Species: Homo sapiens [TaxId:9606]
    Gene: PLACENTAL GUS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3hn3d1, d3hn3d2, d3hn3d3
  • Chain 'E':
    Compound: beta-glucuronidase
    Species: Homo sapiens [TaxId:9606]
    Gene: PLACENTAL GUS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3hn3e1, d3hn3e2, d3hn3e3
  • Heterogens: NDG, MRD, NAG, MPD, BMA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3hn3A (A:)
    lglqggmlypqespsreckeldglwsfradfsdnrrrgfeeqwyrrplwesgptvdmpvp
    ssfndisqdwrlrhfvgwvwyerevilperwtqdlrtrvvlrigsahsyaivwvngvdtl
    eheggylpfeadisnlvqvgplpsrlritiainntltpttlppgtiqyltdtskypkgyf
    vqntyfdffnyaglqrsvllyttpttyidditvttsveqdsglvnyqisvkgsnlfklev
    rlldaenkvvangtgtqgqlkvpgvslwwpylmherpaylyslevqltaqtslgpvsdfy
    tlpvgirtvavtksqflingkpfyfhgvnkhedadirgkgfdwpllvkdfnllrwlgana
    frtshypyaeevmqmcdrygivvidecpgvglalpqffnnvslhhhmqvmeevvrrdknh
    pavvmwsvanepashlesagyylkmviahtksldpsrpvtfvsnsnyaadkgapyvdvic
    lnsyyswyhdyghleliqlqlatqfenwykkyqkpiiqseygaetiagfhqdpplmftee
    yqkslleqyhlgldqkrrkyvvgeliwnfadfmteqsptrvlgnkkgiftrqrqpksaaf
    llrerywkianet
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hn3A (A:)
    glqggmlypqespsreckeldglwsfradfsdnrrrgfeeqwyrrplwesgptvdmpvps
    sfndisqdwrlrhfvgwvwyerevilperwtqdlrtrvvlrigsahsyaivwvngvdtle
    heggylpfeadisnlvqvgsrlritiainntltpttlppgtiqyltdtskypkgyfvqnt
    yfdffnyaglqrsvllyttpttyidditvttsveqdsglvnyqisvkgsnlfklevrlld
    aenkvvangtgtqgqlkvpgvslwwpylmherpaylyslevqltaqtslgpvsdfytlpv
    girtvavtksqflingkpfyfhgvnkhedadirgkgfdwpllvkdfnllrwlganafrts
    hypyaeevmqmcdrygivvidecpgvglalpqffnnvslhhhmqvmeevvrrdknhpavv
    mwsvanepashlesagyylkmviahtksldpsrpvtfvsnsnyaadkgapyvdviclnsy
    yswyhdyghleliqlqlatqfenwykkyqkpiiqseygaetiagfhqdpplmfteeyqks
    lleqyhlgldqkrrkyvvgeliwnfadfmteqsptrvlgnkkgiftrqrqpksaafllre
    rywkiane
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3hn3B (B:)
    lglqggmlypqespsreckeldglwsfradfsdnrrrgfeeqwyrrplwesgptvdmpvp
    ssfndisqdwrlrhfvgwvwyerevilperwtqdlrtrvvlrigsahsyaivwvngvdtl
    eheggylpfeadisnlvqvgplpsrlritiainntltpttlppgtiqyltdtskypkgyf
    vqntyfdffnyaglqrsvllyttpttyidditvttsveqdsglvnyqisvkgsnlfklev
    rlldaenkvvangtgtqgqlkvpgvslwwpylmherpaylyslevqltaqtslgpvsdfy
    tlpvgirtvavtksqflingkpfyfhgvnkhedadirgkgfdwpllvkdfnllrwlgana
    frtshypyaeevmqmcdrygivvidecpgvglalpqffnnvslhhhmqvmeevvrrdknh
    pavvmwsvanepashlesagyylkmviahtksldpsrpvtfvsnsnyaadkgapyvdvic
    lnsyyswyhdyghleliqlqlatqfenwykkyqkpiiqseygaetiagfhqdpplmftee
    yqkslleqyhlgldqkrrkyvvgeliwnfadfmteqsptrvlgnkkgiftrqrqpksaaf
    llrerywkianet
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hn3B (B:)
    glqggmlypqespsreckeldglwsfradfsdnrrrgfeeqwyrrplwesgptvdmpvps
    sfndisqdwrlrhfvgwvwyerevilperwtqdlrtrvvlrigsahsyaivwvngvdtle
    heggylpfeadisnlvqvgsrlritiainntltpttlppgtiqyltdtskypkgyfvqnt
    yfdffnyaglqrsvllyttpttyidditvttsveqdsglvnyqisvkgsnlfklevrlld
    aenkvvangtgtqgqlkvpgvslwwpylmherpaylyslevqltaqtslgpvsdfytlpv
    girtvavtksqflingkpfyfhgvnkhedadirgkgfdwpllvkdfnllrwlganafrts
    hypyaeevmqmcdrygivvidecpgvglalpqffnnvslhhhmqvmeevvrrdknhpavv
    mwsvanepashlesagyylkmviahtksldpsrpvtfvsnsnyaadkgapyvdviclnsy
    yswyhdyghleliqlqlatqfenwykkyqkpiiqseygaetiagfhqdpplmfteeyqks
    lleqyhlgldqkrrkyvvgeliwnfadfmteqsptrvlgnkkgiftrqrqpksaafllre
    rywkianet
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3hn3D (D:)
    lglqggmlypqespsreckeldglwsfradfsdnrrrgfeeqwyrrplwesgptvdmpvp
    ssfndisqdwrlrhfvgwvwyerevilperwtqdlrtrvvlrigsahsyaivwvngvdtl
    eheggylpfeadisnlvqvgplpsrlritiainntltpttlppgtiqyltdtskypkgyf
    vqntyfdffnyaglqrsvllyttpttyidditvttsveqdsglvnyqisvkgsnlfklev
    rlldaenkvvangtgtqgqlkvpgvslwwpylmherpaylyslevqltaqtslgpvsdfy
    tlpvgirtvavtksqflingkpfyfhgvnkhedadirgkgfdwpllvkdfnllrwlgana
    frtshypyaeevmqmcdrygivvidecpgvglalpqffnnvslhhhmqvmeevvrrdknh
    pavvmwsvanepashlesagyylkmviahtksldpsrpvtfvsnsnyaadkgapyvdvic
    lnsyyswyhdyghleliqlqlatqfenwykkyqkpiiqseygaetiagfhqdpplmftee
    yqkslleqyhlgldqkrrkyvvgeliwnfadfmteqsptrvlgnkkgiftrqrqpksaaf
    llrerywkianet
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hn3D (D:)
    lqggmlypqespsreckeldglwsfradfsdnrrrgfeeqwyrrplwesgptvdmpvpss
    fndisqdwrlrhfvgwvwyerevilperwtqdlrtrvvlrigsahsyaivwvngvdtleh
    eggylpfeadisnlvqvsrlritiainntltpttlppgtiqyltdtskypkgyfvqntyf
    dffnyaglqrsvllyttpttyidditvttsveqdsglvnyqisvkgsnlfklevrlldae
    nkvvangtgtqgqlkvpgvslwwpylmherpaylyslevqltaqtslgpvsdfytlpvgi
    rtvavtksqflingkpfyfhgvnkhedadirgkgfdwpllvkdfnllrwlganafrtshy
    pyaeevmqmcdrygivvidecpgvglalpqffnnvslhhhmqvmeevvrrdknhpavvmw
    svanepashlesagyylkmviahtksldpsrpvtfvsnsnyaadkgapyvdviclnsyys
    wyhdyghleliqlqlatqfenwykkyqkpiiqseygaetiagfhqdpplmfteeyqksll
    eqyhlgldqkrrkyvvgeliwnfadfmteqsptrvlgnkkgiftrqrqpksaafllrery
    wkianet
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3hn3E (E:)
    lglqggmlypqespsreckeldglwsfradfsdnrrrgfeeqwyrrplwesgptvdmpvp
    ssfndisqdwrlrhfvgwvwyerevilperwtqdlrtrvvlrigsahsyaivwvngvdtl
    eheggylpfeadisnlvqvgplpsrlritiainntltpttlppgtiqyltdtskypkgyf
    vqntyfdffnyaglqrsvllyttpttyidditvttsveqdsglvnyqisvkgsnlfklev
    rlldaenkvvangtgtqgqlkvpgvslwwpylmherpaylyslevqltaqtslgpvsdfy
    tlpvgirtvavtksqflingkpfyfhgvnkhedadirgkgfdwpllvkdfnllrwlgana
    frtshypyaeevmqmcdrygivvidecpgvglalpqffnnvslhhhmqvmeevvrrdknh
    pavvmwsvanepashlesagyylkmviahtksldpsrpvtfvsnsnyaadkgapyvdvic
    lnsyyswyhdyghleliqlqlatqfenwykkyqkpiiqseygaetiagfhqdpplmftee
    yqkslleqyhlgldqkrrkyvvgeliwnfadfmteqsptrvlgnkkgiftrqrqpksaaf
    llrerywkianet
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hn3E (E:)
    lqggmlypqespsreckeldglwsfradfsdnrrrgfeeqwyrrplwesgptvdmpvpss
    fndisqdwrlrhfvgwvwyerevilperwtqdlrtrvvlrigsahsyaivwvngvdtleh
    eggylpfeadisnlvqvsrlritiainntltpttlppgtiqyltdtskypkgyfvqntyf
    dffnyaglqrsvllyttpttyidditvttsveqdsglvnyqisvkgsnlfklevrlldae
    nkvvangtgtqgqlkvpgvslwwpylmherpaylyslevqltaqtslgpvsdfytlpvgi
    rtvavtksqflingkpfyfhgvnkhedadirgkgfdwpllvkdfnllrwlganafrtshy
    pyaeevmqmcdrygivvidecpgvglalpqffnnvslhhhmqvmeevvrrdknhpavvmw
    svanepashlesagyylkmviahtksldpsrpvtfvsnsnyaadkgapyvdviclnsyys
    wyhdyghleliqlqlatqfenwykkyqkpiiqseygaetiagfhqdpplmfteeyqksll
    eqyhlgldqkrrkyvvgeliwnfadfmteqsptrvlgnkkgiftrqrqpksaafllrery
    wkiane