PDB entry 3hmx

View 3hmx on RCSB PDB site
Description: Crystal structure of ustekinumab FAB/IL-12 complex
Class: Cytokine/IMMUNE SYSTEM
Keywords: USTEKINUMAB, CNTO1275, IL-12, IL-23, ANTIBODY, FAB, MONOCLONAL ANTIBODY, IMMUNE SYSTEM, Cytokine, Disulfide bond, Glycoprotein, Immunoglobulin domain, Secreted, Growth factor, Cytokine-MMUNE SYSTEM COMPLEX, Cytokine-IMMUNE SYSTEM complex
Deposited on 2009-05-29, released 2010-06-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-07-22, with a file datestamp of 2015-07-17.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Interleukin-12 subunit beta
    Species: Homo sapiens [TaxId:9606]
    Gene: IL12B, NKSF2
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Interleukin-12 subunit alpha
    Species: Homo sapiens [TaxId:9606]
    Gene: IL12A, NKSF1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3hmxb_
  • Chain 'H':
    Compound: ustekinumab fab heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3HMX (0-End)
  • Chain 'L':
    Compound: ustekinumab fab light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3HMX (0-213)
    Domains in SCOPe 2.07: d3hmxl1, d3hmxl2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3hmxB (B:)
    rnlpvatpdpgmfpclhhsqnllravsnmlqkarqtlefypctseeidheditkdktstv
    eaclpleltknesclnsretsfitngsclasrktsfmmalclssiyedlkmyqvefktmn
    akllmdpkrqifldqnmlavidelmqalnfnsetvpqkssleepdfyktkiklcillhaf
    riravtidrvmsylnas
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hmxB (B:)
    mfpclhhsqnllravsnmlqkarqtlefypctsdheditkdktstveaclpleltknesc
    etsfitngsclasrktsfmmalclssiyedlkmyqvefktmnakllmdpkrqifldqnml
    avidelmqalnfnsetvpsleepdfyktkiklcillhafriravtidrvmsylnas
    

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3hmxL (L:)
    diqmtqspsslsasvgdrvtitcrasqgisswlawyqqkpekapksliyaasslqsgvps
    rfsgsgsgtdftltisslqpedfatyycqqyniypytfgqgtkleikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec