PDB entry 3hmm

View 3hmm on RCSB PDB site
Description: Structure of Alk5 + GW855857
Class: transferase
Keywords: tgf-beta, alk5, kinase, inhibitor, quinazoline, aortic aneurysm, ATP-binding, craniosynostosis, disease mutation, disulfide bond, glycoprotein, magnesium, manganese, membrane, metal-binding, nucleotide-binding, phosphoprotein polymorphism, receptor, serine/threonine-protein kinase, transferase, transmembrane
Deposited on 2009-05-29, released 2009-06-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: TGF-beta receptor type-1
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3hmma_
  • Heterogens: 855, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3hmmA (A:)
    iartivlqesigkgrfgevwrgkwrgeevavkifssreerswfreaeiyqtvmlrhenil
    gfiaadnkdngtwtqlwlvsdyhehgslfdylnrytvtvegmiklalstasglahlhmei
    vgtqgkpaiahrdlksknilvkkngtcciadlglavrhdsatdtidiapnhrvgtkryma
    pevlddsinmkhfesfkradiyamglvfweiarrcsiggihedyqlpyydlvpsdpsvee
    mrkvvceqklrpnipnrwqscealrvmakimrecwyangaarltalrikktlsqlsqqeg
    ikm
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hmmA (A:)
    iartivlqesigkgrfgevwrgkwrgeevavkifssreerswfreaeiyqtvmlrhenil
    gfiaadnkdngtwtqlwlvsdyhehgslfdylnrytvtvegmiklalstasglahlhmei
    vgtqgkpaiahrdlksknilvkkngtcciadlglavrhdsatdtidiagtkrymapevld
    dsinmkhfesfkradiyamglvfweiarrcsiggihedyqlpyydlvpsdpsveemrkvv
    ceqklrpnipnrwqscealrvmakimrecwyangaarltalrikktlsqlsqq